BLASTX nr result
ID: Scutellaria22_contig00031875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00031875 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] 59 4e-07 emb|CBI34813.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCA... 58 9e-07 >gb|ABL63118.1| AT-hook DNA-binding protein [Catharanthus roseus] Length = 293 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/32 (78%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = -3 Query: 246 DPS-MFQGMPPNLVNSIQMPNEEFWATGRPPF 154 DPS +F GMPPNL+NSIQ+PNE +WATGRPPF Sbjct: 262 DPSALFHGMPPNLLNSIQLPNEAYWATGRPPF 293 >emb|CBI34813.3| unnamed protein product [Vitis vinifera] Length = 240 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = -3 Query: 258 QMLADPS--MFQGMPPNLVNSIQMPNEEFWATGRPPF 154 Q+LADP+ +F G+PPNL+NSIQ+P E +WATGRPP+ Sbjct: 204 QLLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY 240 >ref|XP_002281296.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Vitis vinifera] Length = 302 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 32/37 (86%), Gaps = 2/37 (5%) Frame = -3 Query: 258 QMLADPS--MFQGMPPNLVNSIQMPNEEFWATGRPPF 154 Q+LADP+ +F G+PPNL+NSIQ+P E +WATGRPP+ Sbjct: 266 QLLADPNAPLFHGLPPNLLNSIQLPAEAYWATGRPPY 302