BLASTX nr result
ID: Scutellaria22_contig00031712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00031712 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320064.1| predicted protein [Populus trichocarpa] gi|2... 81 1e-13 ref|XP_002511732.1| cytohesin 1, 2, 3, putative [Ricinus communi... 80 2e-13 ref|XP_004155791.1| PREDICTED: LOW QUALITY PROTEIN: brefeldin A-... 79 5e-13 ref|XP_004133908.1| PREDICTED: brefeldin A-inhibited guanine nuc... 79 5e-13 ref|XP_002301299.1| predicted protein [Populus trichocarpa] gi|2... 78 9e-13 >ref|XP_002320064.1| predicted protein [Populus trichocarpa] gi|222860837|gb|EEE98379.1| predicted protein [Populus trichocarpa] Length = 1783 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 1 EKNLSSFFPLLSCLISCEHGSNEVQLALSDMLSTSVGPVLLRSC 132 EKNL+ FFPLLS LISCEHGSNEVQ+ALSDMLS+SVGPVLLRSC Sbjct: 1740 EKNLAHFFPLLSSLISCEHGSNEVQVALSDMLSSSVGPVLLRSC 1783 >ref|XP_002511732.1| cytohesin 1, 2, 3, putative [Ricinus communis] gi|223548912|gb|EEF50401.1| cytohesin 1, 2, 3, putative [Ricinus communis] Length = 1780 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 1 EKNLSSFFPLLSCLISCEHGSNEVQLALSDMLSTSVGPVLLRSC 132 EKNLS FFPLLS LISCEHGSNEVQ+ALSDMLS++VGPVLLRSC Sbjct: 1737 EKNLSHFFPLLSGLISCEHGSNEVQVALSDMLSSTVGPVLLRSC 1780 >ref|XP_004155791.1| PREDICTED: LOW QUALITY PROTEIN: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Cucumis sativus] Length = 1785 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 1 EKNLSSFFPLLSCLISCEHGSNEVQLALSDMLSTSVGPVLLRSC 132 EKNL+ FPLLS LISCEHGSNEVQLALS+ML+TSVGP+LLRSC Sbjct: 1742 EKNLTGLFPLLSSLISCEHGSNEVQLALSEMLNTSVGPILLRSC 1785 >ref|XP_004133908.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Cucumis sativus] Length = 1785 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +1 Query: 1 EKNLSSFFPLLSCLISCEHGSNEVQLALSDMLSTSVGPVLLRSC 132 EKNL+ FPLLS LISCEHGSNEVQLALS+ML+TSVGP+LLRSC Sbjct: 1742 EKNLTGLFPLLSSLISCEHGSNEVQLALSEMLNTSVGPILLRSC 1785 >ref|XP_002301299.1| predicted protein [Populus trichocarpa] gi|222843025|gb|EEE80572.1| predicted protein [Populus trichocarpa] Length = 201 Score = 77.8 bits (190), Expect = 9e-13 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +1 Query: 1 EKNLSSFFPLLSCLISCEHGSNEVQLALSDMLSTSVGPVLLRSC 132 EK L FFPLLS LISCEHGSNEVQ+ALSDMLS+SVGPVLLRSC Sbjct: 158 EKKLPHFFPLLSSLISCEHGSNEVQVALSDMLSSSVGPVLLRSC 201