BLASTX nr result
ID: Scutellaria22_contig00031703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00031703 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002875956.1| F-box family protein [Arabidopsis lyrata sub... 66 3e-09 ref|NP_178506.3| F-box/FBD/LRR-repeat protein [Arabidopsis thali... 64 1e-08 ref|XP_002880735.1| F-box family protein [Arabidopsis lyrata sub... 64 2e-08 ref|NP_180173.1| F-box/FBD/LRR-repeat protein [Arabidopsis thali... 63 2e-08 emb|CCD74546.1| F-box family protein [Arabidopsis halleri subsp.... 63 2e-08 >ref|XP_002875956.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297321794|gb|EFH52215.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 448 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = -2 Query: 169 DGVSADRLSELPDSLIMQIFSSLPMVDVVRTSILSKRWNHLWTTTPFLDFKDDGN 5 D ++ DR+SELPD+L++QI SSLP + + TS+LSKRW LWT P L F D N Sbjct: 8 DAMNEDRISELPDALLLQILSSLPTENAIATSVLSKRWRSLWTMLPKLKFDCDFN 62 >ref|NP_178506.3| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75223245|sp|Q6NKX3.1|FDL14_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At2g04230 gi|46518465|gb|AAS99714.1| At2g04230 [Arabidopsis thaliana] gi|51971311|dbj|BAD44320.1| hypothetical protein [Arabidopsis thaliana] gi|330250715|gb|AEC05809.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] Length = 448 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -2 Query: 169 DGVSADRLSELPDSLIMQIFSSLPMVDVVRTSILSKRWNHLWTTTPFLDFKDDGN 5 D ++ DR+S+LPD+L++QI SSLP + + TS+LSKRW LWT P L F + N Sbjct: 8 DSMNEDRISDLPDALLLQILSSLPTENAIATSVLSKRWRSLWTMLPKLKFDSNFN 62 >ref|XP_002880735.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297326574|gb|EFH56994.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -2 Query: 163 VSADRLSELPDSLIMQIFSSLPMVDVVRTSILSKRWNHLWTTTPFLDFK 17 ++ DR+SELPDSL+ QI S LP D V+TS+LSKRW LW P LD K Sbjct: 1 MNCDRISELPDSLLTQILSYLPTKDSVKTSVLSKRWEFLWLRVPVLDLK 49 >ref|NP_180173.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|79323090|ref|NP_001031420.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|143016455|sp|Q8H1M0.2|FDL16_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At2g26030 gi|3413710|gb|AAC31233.1| hypothetical protein [Arabidopsis thaliana] gi|50058977|gb|AAT69233.1| hypothetical protein At2g26030 [Arabidopsis thaliana] gi|51971321|dbj|BAD44325.1| unknown protein [Arabidopsis thaliana] gi|330252692|gb|AEC07786.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|330252693|gb|AEC07787.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] Length = 442 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -2 Query: 163 VSADRLSELPDSLIMQIFSSLPMVDVVRTSILSKRWNHLWTTTPFLDFK 17 ++ DR+ ELPDSL+ Q+ S LP +D V+TS+LSKRW LW P LD K Sbjct: 1 MNCDRICELPDSLLTQVLSYLPTIDSVKTSVLSKRWEFLWLRVPVLDLK 49 >emb|CCD74546.1| F-box family protein [Arabidopsis halleri subsp. halleri] Length = 530 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -2 Query: 163 VSADRLSELPDSLIMQIFSSLPMVDVVRTSILSKRWNHLWTTTPFLDFK 17 ++ DR+SELPDSL+ QI S LP D V+TS+LSKRW LW P LD K Sbjct: 90 MNCDRISELPDSLLTQILSYLPTKDSVKTSLLSKRWEFLWLRVPVLDLK 138