BLASTX nr result
ID: Scutellaria22_contig00030986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030986 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003890702.1| hypothetical protein PGTG_20732 [Puccinia gr... 55 8e-06 >ref|XP_003890702.1| hypothetical protein PGTG_20732 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|375166406|gb|EHS63147.1| hypothetical protein PGTG_20732 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 386 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 5/92 (5%) Frame = -3 Query: 353 SDYNDNRPNDT-----PLRNASMIRSHWHNTIQKKCNRFNANFNSLYNVYRSGHSDEDIL 189 ++YNDN+ N P+R + HW + IQK ++F F + +SG S +DI Sbjct: 127 TEYNDNKKNSKNFKPLPIRPVGAVECHWGH-IQKCVSKFAGCFANAERRLKSGKSRDDIF 185 Query: 188 RLSLEKYSSENGGVAFNLLHVWRILKDLTLFQ 93 + E Y + +GG FNL H W ILKD +Q Sbjct: 186 TEAKELYKASSGG-GFNLDHCWGILKDTPKWQ 216