BLASTX nr result
ID: Scutellaria22_contig00030922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030922 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002870861.1| serine/threonine protein kinase family prote... 74 1e-11 ref|XP_003633713.1| PREDICTED: probable serine/threonine-protein... 73 3e-11 dbj|BAB11288.1| unnamed protein product [Arabidopsis thaliana] 70 1e-10 ref|NP_198637.2| protein kinase-like protein [Arabidopsis thalia... 70 1e-10 ref|XP_002339037.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 >ref|XP_002870861.1| serine/threonine protein kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297316697|gb|EFH47120.1| serine/threonine protein kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 686 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/66 (54%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = -3 Query: 465 AELAFRCLQQERDMRPSMEEVLEALKGIQNEDLNAHKVEIVDLSMD--DDVGLLKGSITP 292 AELAFRCLQQER++RPSM+E++E LKGIQ E + K +V++ ++ DDVGLLK + P Sbjct: 606 AELAFRCLQQEREVRPSMDEIVEILKGIQKEGIKDSKDVVVEIDVNGGDDVGLLKHGVPP 665 Query: 291 PRSQDS 274 P S ++ Sbjct: 666 PLSPET 671 >ref|XP_003633713.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like [Vitis vinifera] Length = 648 Score = 72.8 bits (177), Expect = 3e-11 Identities = 40/65 (61%), Positives = 50/65 (76%) Frame = -3 Query: 465 AELAFRCLQQERDMRPSMEEVLEALKGIQNEDLNAHKVEIVDLSMDDDVGLLKGSITPPR 286 AELAFRCLQ ERDMRP+M EVL+AL+ I+NE+ + K E VD++ +D+GLLK S PP Sbjct: 572 AELAFRCLQHERDMRPTMGEVLKALRRIENEESDVQKAEEVDIN-SEDIGLLK-SNPPPV 629 Query: 285 SQDSV 271 S DSV Sbjct: 630 SPDSV 634 >dbj|BAB11288.1| unnamed protein product [Arabidopsis thaliana] Length = 978 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/66 (51%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = -3 Query: 465 AELAFRCLQQERDMRPSMEEVLEALKGIQNEDLNAHKVEIVDLSMD--DDVGLLKGSITP 292 AELAFRCLQQERD+RPSM+E++E L+ IQ + ++ K +V++ ++ DDVGLLK + P Sbjct: 898 AELAFRCLQQERDVRPSMDEIVEVLRVIQKDGISDSKDVVVEIDVNGGDDVGLLKHGVPP 957 Query: 291 PRSQDS 274 P S ++ Sbjct: 958 PLSPET 963 >ref|NP_198637.2| protein kinase-like protein [Arabidopsis thaliana] gi|18175791|gb|AAL59928.1| putative protein kinase [Arabidopsis thaliana] gi|22136902|gb|AAM91795.1| putative protein kinase [Arabidopsis thaliana] gi|332006898|gb|AED94281.1| protein kinase-like protein [Arabidopsis thaliana] Length = 686 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/66 (51%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = -3 Query: 465 AELAFRCLQQERDMRPSMEEVLEALKGIQNEDLNAHKVEIVDLSMD--DDVGLLKGSITP 292 AELAFRCLQQERD+RPSM+E++E L+ IQ + ++ K +V++ ++ DDVGLLK + P Sbjct: 606 AELAFRCLQQERDVRPSMDEIVEVLRVIQKDGISDSKDVVVEIDVNGGDDVGLLKHGVPP 665 Query: 291 PRSQDS 274 P S ++ Sbjct: 666 PLSPET 671 >ref|XP_002339037.1| predicted protein [Populus trichocarpa] gi|222874248|gb|EEF11379.1| predicted protein [Populus trichocarpa] Length = 129 Score = 68.9 bits (167), Expect = 4e-10 Identities = 38/68 (55%), Positives = 49/68 (72%) Frame = -3 Query: 465 AELAFRCLQQERDMRPSMEEVLEALKGIQNEDLNAHKVEIVDLSMDDDVGLLKGSITPPR 286 AELAF+CLQ +++RPSMEEVL+ LK IQ+ D NA K E ++ S DDVG+LK PP Sbjct: 52 AELAFQCLQNAKELRPSMEEVLQILKEIQSRDYNAEKAEDIN-SPSDDVGMLKSGPIPP- 109 Query: 285 SQDSV*LT 262 S D+V +T Sbjct: 110 SPDTVTVT 117