BLASTX nr result
ID: Scutellaria22_contig00030747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030747 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326146.1| predicted protein [Populus trichocarpa] gi|2... 107 8e-22 ref|XP_002516209.1| microtubule motor, putative [Ricinus communi... 107 1e-21 dbj|BAB86284.1| kinesin-like protein NACK2 [Nicotiana tabacum] 104 7e-21 ref|NP_189907.2| ATP binding microtubule motor family protein [A... 103 1e-20 ref|XP_002875601.1| hypothetical protein ARALYDRAFT_323079 [Arab... 103 1e-20 >ref|XP_002326146.1| predicted protein [Populus trichocarpa] gi|222833339|gb|EEE71816.1| predicted protein [Populus trichocarpa] Length = 952 Score = 107 bits (268), Expect = 8e-22 Identities = 48/74 (64%), Positives = 62/74 (83%) Frame = +1 Query: 40 AKEMASGDEEEVEITGTLSSMPWNMVFEEQRKEIIMLWHVCHVSIVHRTQFYLLFRGDPS 219 A E A+ + E+++ S MPW++VF++QRK+IIMLWH+CHVSI+HRTQFYLLFRG+P Sbjct: 748 ANEEATTETEKMD----QSPMPWHLVFDDQRKQIIMLWHLCHVSIIHRTQFYLLFRGEPG 803 Query: 220 DQIYMEVELRRLKW 261 DQIY+EVELRRL W Sbjct: 804 DQIYLEVELRRLTW 817 >ref|XP_002516209.1| microtubule motor, putative [Ricinus communis] gi|223544695|gb|EEF46211.1| microtubule motor, putative [Ricinus communis] Length = 891 Score = 107 bits (267), Expect = 1e-21 Identities = 48/72 (66%), Positives = 59/72 (81%) Frame = +1 Query: 46 EMASGDEEEVEITGTLSSMPWNMVFEEQRKEIIMLWHVCHVSIVHRTQFYLLFRGDPSDQ 225 E G E++I S M W+++FE+QRK+I+MLWH+CHVSI+HRTQFYLLF+GDPSDQ Sbjct: 741 EANEGTTAEMDIIDQ-SPMAWHLLFEDQRKQIVMLWHLCHVSIIHRTQFYLLFKGDPSDQ 799 Query: 226 IYMEVELRRLKW 261 IYMEVELRRL W Sbjct: 800 IYMEVELRRLSW 811 >dbj|BAB86284.1| kinesin-like protein NACK2 [Nicotiana tabacum] Length = 955 Score = 104 bits (260), Expect = 7e-21 Identities = 46/70 (65%), Positives = 59/70 (84%) Frame = +1 Query: 52 ASGDEEEVEITGTLSSMPWNMVFEEQRKEIIMLWHVCHVSIVHRTQFYLLFRGDPSDQIY 231 A+ DE ++ LS W++VFE+QR++IIMLWH+CHVS+VHRTQFY+LF+GDPSDQIY Sbjct: 753 AASDEADISDQSPLS---WHLVFEDQRQQIIMLWHLCHVSLVHRTQFYMLFKGDPSDQIY 809 Query: 232 MEVELRRLKW 261 +EVELRRL W Sbjct: 810 LEVELRRLTW 819 >ref|NP_189907.2| ATP binding microtubule motor family protein [Arabidopsis thaliana] gi|21743232|dbj|BAC03248.1| kinesin-like protein [Arabidopsis thaliana] gi|332644253|gb|AEE77774.1| ATP binding microtubule motor family protein [Arabidopsis thaliana] Length = 938 Score = 103 bits (258), Expect = 1e-20 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = +1 Query: 94 SSMPWNMVFEEQRKEIIMLWHVCHVSIVHRTQFYLLFRGDPSDQIYMEVELRRLKW 261 S M W + FEEQRK+IIMLWH+CH+SI+HRTQFY+LF+GDP+DQIYMEVELRRL W Sbjct: 747 SQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFYMLFKGDPADQIYMEVELRRLTW 802 >ref|XP_002875601.1| hypothetical protein ARALYDRAFT_323079 [Arabidopsis lyrata subsp. lyrata] gi|297321439|gb|EFH51860.1| hypothetical protein ARALYDRAFT_323079 [Arabidopsis lyrata subsp. lyrata] Length = 942 Score = 103 bits (258), Expect = 1e-20 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = +1 Query: 94 SSMPWNMVFEEQRKEIIMLWHVCHVSIVHRTQFYLLFRGDPSDQIYMEVELRRLKW 261 S M W + FEEQRK+IIMLWH+CH+SI+HRTQFY+LF+GDP+DQIYMEVELRRL W Sbjct: 751 SQMDWPLCFEEQRKQIIMLWHLCHISIIHRTQFYMLFKGDPADQIYMEVELRRLTW 806