BLASTX nr result
ID: Scutellaria22_contig00030721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030721 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus commun... 69 5e-10 ref|XP_002324032.1| thioredoxin h [Populus trichocarpa] gi|22286... 66 3e-09 ref|XP_004147463.1| PREDICTED: thioredoxin H2-like [Cucumis sati... 65 6e-09 ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS... 65 6e-09 gb|ACU15762.1| unknown [Glycine max] 65 6e-09 >ref|XP_002517458.1| Thioredoxin H-type, putative [Ricinus communis] gi|223543469|gb|EEF45000.1| Thioredoxin H-type, putative [Ricinus communis] Length = 133 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 185 AEEFGVETMPTFVFVKRGKEVDRVVGAKKEDINKKIEKHR 66 A+EFGV+ MPTFV VK+GKEVDRVVGAKK+++ KKIEKHR Sbjct: 92 AQEFGVQAMPTFVLVKKGKEVDRVVGAKKDELLKKIEKHR 131 >ref|XP_002324032.1| thioredoxin h [Populus trichocarpa] gi|222867034|gb|EEF04165.1| thioredoxin h [Populus trichocarpa] Length = 131 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 185 AEEFGVETMPTFVFVKRGKEVDRVVGAKKEDINKKIEKHR 66 A+EFGV+ MPTFV VK+G EVDRVVGA+KE++ +KIEKHR Sbjct: 92 AQEFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKHR 131 >ref|XP_004147463.1| PREDICTED: thioredoxin H2-like [Cucumis sativus] gi|449523231|ref|XP_004168627.1| PREDICTED: thioredoxin H2-like [Cucumis sativus] Length = 144 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 185 AEEFGVETMPTFVFVKRGKEVDRVVGAKKEDINKKIEKHR 66 A+ FGV+ MPTFVF+KRGK VD VVGA+KE++ KKIEKHR Sbjct: 99 AQHFGVQAMPTFVFLKRGKVVDTVVGARKEELEKKIEKHR 138 >ref|NP_001237440.1| thioredoxin [Glycine max] gi|46326970|gb|AAS88427.1| thioredoxin [Glycine max] Length = 135 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 185 AEEFGVETMPTFVFVKRGKEVDRVVGAKKEDINKKIEKHR 66 A+EF VE MPTFV K+GKEVD+VVGAKK+++ KKIEKHR Sbjct: 93 AKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR 132 >gb|ACU15762.1| unknown [Glycine max] Length = 157 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 185 AEEFGVETMPTFVFVKRGKEVDRVVGAKKEDINKKIEKHR 66 A+EF VE MPTFV K+GKEVD+VVGAKK+++ KKIEKHR Sbjct: 115 AKEFNVEAMPTFVLCKKGKEVDKVVGAKKDELEKKIEKHR 154