BLASTX nr result
ID: Scutellaria22_contig00030513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00030513 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526135.1| PREDICTED: G-type lectin S-receptor-like ser... 57 2e-06 >ref|XP_003526135.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Glycine max] Length = 782 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = -2 Query: 212 LFQKITLLSVFIFVFFTTPAIS---DTLDTSQSIRDGETVVSSXXXXXXXXXXXGNSSNR 42 + + I +L ++ F+FF P S D+L QSIRDGET+VS+ GNS+ R Sbjct: 1 MVRSIIMLCIWFFIFFDLPGTSTLIDSLAAGQSIRDGETLVSAGGITKVGFFSPGNSTRR 60 Query: 41 WYLGIWYRNITP 6 YLGIWY N++P Sbjct: 61 -YLGIWYTNVSP 71