BLASTX nr result
ID: Scutellaria22_contig00028871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00028871 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518267.1| Cylicin-2, putative [Ricinus communis] gi|22... 59 5e-07 >ref|XP_002518267.1| Cylicin-2, putative [Ricinus communis] gi|223542614|gb|EEF44153.1| Cylicin-2, putative [Ricinus communis] Length = 458 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/76 (40%), Positives = 47/76 (61%) Frame = +2 Query: 179 LKPEDDSILVFSVALWLQNKGFSKVLKRFLSAAQIQDDDWKAKALNLNEIFSKYQESCNS 358 LKPE ++L+ S+A +L+ GFSK +K+F S A+IQ DD + +L E+F K + N Sbjct: 49 LKPEQKTLLLNSIAQYLERSGFSKTVKKFRSEARIQKDDLIESSFDLQEMFIKILDMRNH 108 Query: 359 TYKDLKSPKKQEEQVL 406 K+ KS + QE Q + Sbjct: 109 ANKNSKSHRVQELQTV 124