BLASTX nr result
ID: Scutellaria22_contig00028732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00028732 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002881224.1| glutamate receptor 3.5 precursor [Arabidopsi... 130 1e-28 gb|AAD50976.1|AF170494_1 ionotropic glutamate receptor ortholog ... 129 2e-28 ref|NP_001031464.1| glutamate receptor 3.5 [Arabidopsis thaliana... 129 2e-28 ref|NP_565743.1| glutamate receptor 3.5 [Arabidopsis thaliana] g... 129 2e-28 sp|Q9SW97.2|GLR35_ARATH RecName: Full=Glutamate receptor 3.5; Al... 129 2e-28 >ref|XP_002881224.1| glutamate receptor 3.5 precursor [Arabidopsis lyrata subsp. lyrata] gi|297327063|gb|EFH57483.1| glutamate receptor 3.5 precursor [Arabidopsis lyrata subsp. lyrata] Length = 958 Score = 130 bits (326), Expect = 1e-28 Identities = 64/80 (80%), Positives = 70/80 (87%) Frame = -2 Query: 240 FVDDEYGRNGVSVLGDALAKKRGKISYKAALTPGASTSEIDSLLVAVNLLESRIFVVHVN 61 FVDDEYGRNG+SVLGD LAKKR KISYKAA TPGA +S I LL +VNL+ESRIFVVHVN Sbjct: 189 FVDDEYGRNGISVLGDILAKKRAKISYKAAFTPGADSSSISDLLASVNLMESRIFVVHVN 248 Query: 60 PDSGLDIFSMAKRLGMMSSG 1 PDSGL+IFS+AK LGMM SG Sbjct: 249 PDSGLNIFSVAKSLGMMGSG 268 >gb|AAD50976.1|AF170494_1 ionotropic glutamate receptor ortholog GLR6 [Arabidopsis thaliana] Length = 950 Score = 129 bits (324), Expect = 2e-28 Identities = 64/80 (80%), Positives = 69/80 (86%) Frame = -2 Query: 240 FVDDEYGRNGVSVLGDALAKKRGKISYKAALTPGASTSEIDSLLVAVNLLESRIFVVHVN 61 FVDDEYGRNG+SVLGDALAKKR KISYKAA PGA S I LL +VNL+ESRIFVVHVN Sbjct: 184 FVDDEYGRNGISVLGDALAKKRAKISYKAAFPPGADNSSISDLLASVNLMESRIFVVHVN 243 Query: 60 PDSGLDIFSMAKRLGMMSSG 1 PDSGL+IFS+AK LGMM SG Sbjct: 244 PDSGLNIFSVAKSLGMMGSG 263 >ref|NP_001031464.1| glutamate receptor 3.5 [Arabidopsis thaliana] gi|330253583|gb|AEC08677.1| glutamate receptor 3.5 [Arabidopsis thaliana] Length = 851 Score = 129 bits (324), Expect = 2e-28 Identities = 64/80 (80%), Positives = 69/80 (86%) Frame = -2 Query: 240 FVDDEYGRNGVSVLGDALAKKRGKISYKAALTPGASTSEIDSLLVAVNLLESRIFVVHVN 61 FVDDEYGRNG+SVLGDALAKKR KISYKAA PGA S I LL +VNL+ESRIFVVHVN Sbjct: 85 FVDDEYGRNGISVLGDALAKKRAKISYKAAFPPGADNSSISDLLASVNLMESRIFVVHVN 144 Query: 60 PDSGLDIFSMAKRLGMMSSG 1 PDSGL+IFS+AK LGMM SG Sbjct: 145 PDSGLNIFSVAKSLGMMGSG 164 >ref|NP_565743.1| glutamate receptor 3.5 [Arabidopsis thaliana] gi|20197431|gb|AAC69939.2| putative ligand-gated ion channel subunit [Arabidopsis thaliana] gi|330253582|gb|AEC08676.1| glutamate receptor 3.5 [Arabidopsis thaliana] Length = 895 Score = 129 bits (324), Expect = 2e-28 Identities = 64/80 (80%), Positives = 69/80 (86%) Frame = -2 Query: 240 FVDDEYGRNGVSVLGDALAKKRGKISYKAALTPGASTSEIDSLLVAVNLLESRIFVVHVN 61 FVDDEYGRNG+SVLGDALAKKR KISYKAA PGA S I LL +VNL+ESRIFVVHVN Sbjct: 129 FVDDEYGRNGISVLGDALAKKRAKISYKAAFPPGADNSSISDLLASVNLMESRIFVVHVN 188 Query: 60 PDSGLDIFSMAKRLGMMSSG 1 PDSGL+IFS+AK LGMM SG Sbjct: 189 PDSGLNIFSVAKSLGMMGSG 208 >sp|Q9SW97.2|GLR35_ARATH RecName: Full=Glutamate receptor 3.5; AltName: Full=Ionotropic glutamate receptor GLR6; AltName: Full=Ligand-gated ion channel 3.5; Flags: Precursor Length = 953 Score = 129 bits (324), Expect = 2e-28 Identities = 64/80 (80%), Positives = 69/80 (86%) Frame = -2 Query: 240 FVDDEYGRNGVSVLGDALAKKRGKISYKAALTPGASTSEIDSLLVAVNLLESRIFVVHVN 61 FVDDEYGRNG+SVLGDALAKKR KISYKAA PGA S I LL +VNL+ESRIFVVHVN Sbjct: 187 FVDDEYGRNGISVLGDALAKKRAKISYKAAFPPGADNSSISDLLASVNLMESRIFVVHVN 246 Query: 60 PDSGLDIFSMAKRLGMMSSG 1 PDSGL+IFS+AK LGMM SG Sbjct: 247 PDSGLNIFSVAKSLGMMGSG 266