BLASTX nr result
ID: Scutellaria22_contig00028375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00028375 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD56221.1| hypothetical protein [Cicer arietinum] 73 2e-11 ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi... 59 5e-07 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +3 Query: 186 HQLWKVLRISCSFYYLVASTACFVHIIKIQVIAERE 293 HQLWK+LRISCSFYYLVAS+ACFVHI+KIQV+AERE Sbjct: 12 HQLWKILRISCSFYYLVASSACFVHIMKIQVLAERE 47 >ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi|355501156|gb|AES82359.1| RNA-binding protein [Medicago truncatula] Length = 454 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 198 KVLRISCSFYYLVASTACFVHIIKIQVIAERE 293 ++LRISCSFYYLVAS+ACFVH +KIQV+AERE Sbjct: 264 EILRISCSFYYLVASSACFVHNLKIQVLAERE 295