BLASTX nr result
ID: Scutellaria22_contig00028228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00028228 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_002518527.1| pentatricopeptide repeat-containing protein,... 69 3e-10 >ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|222848569|gb|EEE86116.1| predicted protein [Populus trichocarpa] Length = 564 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/106 (32%), Positives = 63/106 (59%) Frame = +1 Query: 1 PLLNSIVQDHPPAKIVSLLQPRRSADSQSISPILNSVIECYCNKQLYLRSLEFYQMAKQY 180 P+++S+V+ H + + + S S + V+ECY +K L++ SLE ++ + Sbjct: 107 PIMDSLVKTHHVSVLGEAMVDSCRGKSLK-SDAFSFVLECYSHKGLFMESLEMFRKMRGN 165 Query: 181 RVRLSVDTCNSLLNLLADKNEPRLAWCFYASILRNGILGNNFTWSV 318 S CNS+L++L +NE +LAWCFY +++++G+L + TWS+ Sbjct: 166 GFIASGTACNSVLDVLQRENEIKLAWCFYCAMIKDGVLPDKLTWSL 211 >ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170-like [Vitis vinifera] Length = 569 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/98 (36%), Positives = 64/98 (65%), Gaps = 1/98 (1%) Frame = +1 Query: 4 LLNSIVQDHPPAKIV-SLLQPRRSADSQSISPILNSVIECYCNKQLYLRSLEFYQMAKQY 180 +L+S+++ + +V S++Q R DS+S P+L V+ECY +K L++ +LE ++ + Sbjct: 116 ILDSLIETQKVSVLVDSVIQACRGKDSES--PVLGFVLECYSSKGLFIEALEVFRRITIH 173 Query: 181 RVRLSVDTCNSLLNLLADKNEPRLAWCFYASILRNGIL 294 SV +CN+LL+ L +NE +LAWC +++RNG+L Sbjct: 174 GYVPSVRSCNALLDSLQRENEIKLAWCVCGALIRNGVL 211 >ref|XP_002518527.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542372|gb|EEF43914.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 599 Score = 69.3 bits (168), Expect = 3e-10 Identities = 38/106 (35%), Positives = 63/106 (59%), Gaps = 1/106 (0%) Frame = +1 Query: 4 LLNSIVQDHPPAKIV-SLLQPRRSADSQSISPILNSVIECYCNKQLYLRSLEFYQMAKQY 180 +L+S+++ +P + +++Q R S+ LN V+E Y +K +L LE Y+ + Sbjct: 137 ILDSLIKTYPSNLFLETMVQACRG--KSSLLCTLNFVLEFYSHKGSFLEGLEVYKKMRVI 194 Query: 181 RVRLSVDTCNSLLNLLADKNEPRLAWCFYASILRNGILGNNFTWSV 318 SV CN LL+ L ++E RLAWCFY +++R G+L + FTWS+ Sbjct: 195 GCTPSVHACNVLLDALQRESEIRLAWCFYCAMIRVGVLPDKFTWSL 240