BLASTX nr result
ID: Scutellaria22_contig00028226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00028226 (238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9ZWR8.1|ANTA_GENTR RecName: Full=Anthocyanin 5-aromatic acyl... 56 3e-06 >sp|Q9ZWR8.1|ANTA_GENTR RecName: Full=Anthocyanin 5-aromatic acyltransferase; Short=5AT gi|4185599|dbj|BAA74428.1| Anthocyanin 5-aromatic acyltransferase [Gentiana triflora] Length = 469 Score = 55.8 bits (133), Expect = 3e-06 Identities = 35/82 (42%), Positives = 51/82 (62%), Gaps = 7/82 (8%) Frame = -3 Query: 230 FMGAWMTVNRFGEDSHLLA---LPSYDRSSVEGSERLTNAIW----DVIKMSNPTVGSTP 72 F+ AW +N+FG+D+ LL+ LPS+DRS ++ L W DV++M + GS P Sbjct: 185 FINAWAYINKFGKDADLLSANLLPSFDRSIIKDLYGLEETFWNEMQDVLEMFS-RFGSKP 243 Query: 71 TSPTNKVRATFLLSDIQIQKMK 6 NKVRAT++LS +IQK+K Sbjct: 244 PR-FNKVRATYVLSLAEIQKLK 264