BLASTX nr result
ID: Scutellaria22_contig00028192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00028192 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525387.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 57 2e-06 ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 56 3e-06 ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi... 56 3e-06 >ref|XP_003525387.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = -2 Query: 307 EYCEKHAMSED---AAGEETSDDELNEDEYASSDEEIAGKPDP 188 EYCEK+A ED A E +SDDEL+ED+YASSD+ I G+PDP Sbjct: 141 EYCEKYAKPEDVGAAQEESSSDDELSEDDYASSDDAIVGQPDP 183 >ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = -2 Query: 307 EYCEKHAMSED---AAGEETSDDELNEDEYASSDEEIAGKPDP 188 EYCEK+A ED A E +SD+EL+EDEY SSDE++AGK DP Sbjct: 141 EYCEKYAKPEDIGAATEENSSDEELSEDEYDSSDEQVAGKADP 183 >ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi|6066285|gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max] Length = 183 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/43 (62%), Positives = 32/43 (74%), Gaps = 3/43 (6%) Frame = -2 Query: 307 EYCEKHAMSED---AAGEETSDDELNEDEYASSDEEIAGKPDP 188 EYCEK+A ED A E +SD+EL EDEY SSDE++AGK DP Sbjct: 141 EYCEKYAKPEDIGAATEENSSDEELTEDEYDSSDEQVAGKADP 183