BLASTX nr result
ID: Scutellaria22_contig00027908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027908 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528486.1| ATP binding protein, putative [Ricinus commu... 57 1e-06 >ref|XP_002528486.1| ATP binding protein, putative [Ricinus communis] gi|223532095|gb|EEF33903.1| ATP binding protein, putative [Ricinus communis] Length = 312 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/45 (51%), Positives = 35/45 (77%) Frame = +2 Query: 149 NIALYISVAVVAFVISKIIMAILCYRRWKKKQMLIQDSFRGASLI 283 +IALYI+V +AF+ISK I+A+LCY+RWKKK ++ + F G ++ Sbjct: 6 DIALYITVCCIAFIISKTIIAVLCYQRWKKKHLVHEGGFSGGKMV 50