BLASTX nr result
ID: Scutellaria22_contig00027735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027735 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276825.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 60 2e-07 ref|XP_002276804.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 57 1e-06 emb|CBI33785.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002272457.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 56 3e-06 ref|XP_002526109.1| UDP-glucuronosyltransferase, putative [Ricin... 56 3e-06 >ref|XP_002276825.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 453 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/56 (51%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -3 Query: 269 ESGIIRQEEIRKKVELLLTDESYKTRALNLQSKAVSSAR--GRSENNFSNFVNWIK 108 E+GII ++EI+ KV LL DE +++RALNL+ A+ S + G S NNF NFV W+K Sbjct: 397 ENGIITRKEIKNKVGQLLGDEKFRSRALNLKEMAIDSVKEGGPSHNNFKNFVEWLK 452 >ref|XP_002276804.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 454 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 269 ESGIIRQEEIRKKVELLLTDESYKTRALNLQSKAVSSAR--GRSENNFSNFVNWIK 108 E+GII +EEIR K+ELL + +K RALNL+ A++ + G S NF NF+ WIK Sbjct: 398 ENGIIMREEIRNKMELLFGESEFKARALNLKEMAMNGVQEGGCSSKNFKNFIEWIK 453 >emb|CBI33785.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 269 ESGIIRQEEIRKKVELLLTDESYKTRALNLQSKAVSSAR--GRSENNFSNFVNWIK 108 E GII +EEI+ KVE LL DE+++ RA NL+ A++ R G S NNF F+ W+K Sbjct: 371 ERGIITREEIKHKVEQLLGDENFRIRASNLKESAMNCVREGGSSYNNFQRFIQWLK 426 >ref|XP_002272457.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 453 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 269 ESGIIRQEEIRKKVELLLTDESYKTRALNLQSKAVSSAR--GRSENNFSNFVNWIK 108 E GII +EEI+ KVE LL DE+++ RA NL+ A++ R G S NNF F+ W+K Sbjct: 397 ERGIITREEIKHKVEQLLGDENFRIRASNLKESAMNCVREGGSSYNNFQRFIQWLK 452 >ref|XP_002526109.1| UDP-glucuronosyltransferase, putative [Ricinus communis] gi|223534606|gb|EEF36303.1| UDP-glucuronosyltransferase, putative [Ricinus communis] Length = 409 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -3 Query: 269 ESGIIRQEEIRKKVELLLTDESYKTRALNLQSKAVSSA--RGRSENNFSNFVNWIK 108 ESGII +EEI+ K+E +++DE++K RAL L+ A+ S G S N F NF++WIK Sbjct: 353 ESGIITREEIKNKMEQVVSDENFKARALQLKEIALESVGESGHSNNVFRNFLDWIK 408