BLASTX nr result
ID: Scutellaria22_contig00027716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027716 (500 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 64 1e-08 ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 57 5e-07 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 44 6e-06 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 314 MPARKNRSLASRTSGALSPIWRHSENHAFRTERNARLPNQ 195 +PARKNRSLASRTSG PI RH+ENHAFRTERNARLP + Sbjct: 81 LPARKNRSLASRTSGG--PIRRHTENHAFRTERNARLPKK 118 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 57.4 bits (137), Expect(2) = 5e-07 Identities = 29/46 (63%), Positives = 30/46 (65%) Frame = -2 Query: 394 YACIFSLDSRIFCFSGGGEQWCLRCSRCLPERTAH*LAGLVGPYLL 257 YAC+F LDSRIFCFSGGGEQ LRC RC P VGP LL Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPP----------VGPGLL 274 Score = 21.2 bits (43), Expect(2) = 5e-07 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -1 Query: 413 LALDHYLCMY 384 L+LDHY C++ Sbjct: 234 LSLDHYACLF 243 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 44.3 bits (103), Expect(2) = 6e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +3 Query: 303 SGRHLLQRKHHCSPPPEKQKIRES 374 +G HL QRK HCSPPP+KQKIRES Sbjct: 294 TGGHLPQRKLHCSPPPDKQKIRES 317 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 259 GDRAPLVRLASERFFRA 309 G+ PLVRLASERFFRA Sbjct: 271 GNGPPLVRLASERFFRA 287