BLASTX nr result
ID: Scutellaria22_contig00027528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027528 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145914.1| PREDICTED: probable beta-1,3-galactosyltrans... 56 3e-06 >ref|XP_004145914.1| PREDICTED: probable beta-1,3-galactosyltransferase 11-like [Cucumis sativus] gi|449497292|ref|XP_004160363.1| PREDICTED: probable beta-1,3-galactosyltransferase 11-like [Cucumis sativus] Length = 339 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 114 MQSKGSSVRFMGMVIRSRISTLTFSMFATFASLYVAGR 1 M+SKGS+ R GM IRSRI TL SMFATFAS+YVAGR Sbjct: 1 MRSKGSNARLSGMPIRSRIPTLLLSMFATFASIYVAGR 38