BLASTX nr result
ID: Scutellaria22_contig00027509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027509 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278311.2| PREDICTED: probable phosphatidylinositol 4-k... 67 2e-09 emb|CBI32835.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_002523668.1| inositol or phosphatidylinositol kinase, put... 56 3e-06 >ref|XP_002278311.2| PREDICTED: probable phosphatidylinositol 4-kinase type 2-beta At1g26270-like [Vitis vinifera] Length = 563 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/55 (60%), Positives = 40/55 (72%) Frame = -1 Query: 242 VPKHNQEGQCICLGEMKEEEWRMFLENFQKLLPEAFEERKSMGLLRQRLGSSCEF 78 V N E I GEM E EW++FLE F+KLLP+AFE+ K+MG LRQRLG+SC F Sbjct: 510 VQNRNHETGGISFGEMSEVEWKLFLECFEKLLPQAFEDTKNMG-LRQRLGTSCRF 563 >emb|CBI32835.3| unnamed protein product [Vitis vinifera] Length = 377 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = -1 Query: 242 VPKHNQEGQCICLGEMKEEEWRMFLENFQKLLPEAFEERKSMGLLRQRLGSSC 84 V N E I GEM E EW++FLE F+KLLP+AFE+ K+MG LRQRLG+SC Sbjct: 280 VQNRNHETGGISFGEMSEVEWKLFLECFEKLLPQAFEDTKNMG-LRQRLGTSC 331 >ref|XP_002523668.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] gi|223537068|gb|EEF38703.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] Length = 570 Score = 55.8 bits (133), Expect = 3e-06 Identities = 34/73 (46%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = -1 Query: 293 DENG-KGXXXXXXXXXXSVPKHNQEGQCICLGEMKEEEWRMFLENFQKLLPEAFEERKSM 117 DENG K SV N E + I LG+M + EW +FL+ F+KLLPEAFE K M Sbjct: 499 DENGSKALGGLTRSISYSVENCNCETESISLGDMSKGEWELFLKCFEKLLPEAFEGTKCM 558 Query: 116 GLLRQRLGSSCEF 78 + RLG+SC+F Sbjct: 559 A-PKLRLGTSCQF 570