BLASTX nr result
ID: Scutellaria22_contig00027236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027236 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534534.1| NAC domain-containing protein, putative [Ric... 156 2e-36 ref|XP_002454285.1| hypothetical protein SORBIDRAFT_04g028015 [S... 146 2e-33 gb|AFW73407.1| putative NAC domain transcription factor superfam... 144 6e-33 ref|XP_002278256.2| PREDICTED: putative NAC domain-containing pr... 144 7e-33 emb|CBI22222.3| unnamed protein product [Vitis vinifera] 144 7e-33 >ref|XP_002534534.1| NAC domain-containing protein, putative [Ricinus communis] gi|223525097|gb|EEF27849.1| NAC domain-containing protein, putative [Ricinus communis] Length = 399 Score = 156 bits (394), Expect = 2e-36 Identities = 69/78 (88%), Positives = 74/78 (94%) Frame = +1 Query: 10 EKSHDSDKNIDEIMLPGFRFHPTDEELVEFYLKRKLQHRSLPIELIKQVDIYKYDPWDLP 189 E+ HD DKNID++MLPGFRFHPTDEELV FYLKRK+Q RSLPIELIKQVDIYKYDPWDLP Sbjct: 2 EEKHDVDKNIDDVMLPGFRFHPTDEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLP 61 Query: 190 KLASTGEKEWYFYCPRDR 243 KLA+TGEKEWYFYCPRDR Sbjct: 62 KLATTGEKEWYFYCPRDR 79 >ref|XP_002454285.1| hypothetical protein SORBIDRAFT_04g028015 [Sorghum bicolor] gi|241934116|gb|EES07261.1| hypothetical protein SORBIDRAFT_04g028015 [Sorghum bicolor] Length = 388 Score = 146 bits (368), Expect = 2e-33 Identities = 66/81 (81%), Positives = 74/81 (91%) Frame = +1 Query: 1 MDDEKSHDSDKNIDEIMLPGFRFHPTDEELVEFYLKRKLQHRSLPIELIKQVDIYKYDPW 180 MD+ +S D +K DE+MLPGFRFHPTDEELV FYLKRK+Q +SLPIELI+Q+DIYKYDPW Sbjct: 1 MDEIRSDDIEKQ-DEVMLPGFRFHPTDEELVRFYLKRKIQQKSLPIELIRQLDIYKYDPW 59 Query: 181 DLPKLASTGEKEWYFYCPRDR 243 DLPKLASTGEKEWYFYCPRDR Sbjct: 60 DLPKLASTGEKEWYFYCPRDR 80 >gb|AFW73407.1| putative NAC domain transcription factor superfamily protein [Zea mays] Length = 386 Score = 144 bits (364), Expect = 6e-33 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +1 Query: 1 MDDEKSHDSDKNIDEIMLPGFRFHPTDEELVEFYLKRKLQHRSLPIELIKQVDIYKYDPW 180 MD +S D +K DE+MLPGFRFHPTDEELV FYLKRK+Q +SLPIELI+Q+DIYKYDPW Sbjct: 1 MDAIRSDDIEKQ-DEVMLPGFRFHPTDEELVRFYLKRKIQQKSLPIELIRQLDIYKYDPW 59 Query: 181 DLPKLASTGEKEWYFYCPRDR 243 DLPKLASTGEKEWYFYCPRDR Sbjct: 60 DLPKLASTGEKEWYFYCPRDR 80 >ref|XP_002278256.2| PREDICTED: putative NAC domain-containing protein 94-like [Vitis vinifera] Length = 389 Score = 144 bits (363), Expect = 7e-33 Identities = 65/75 (86%), Positives = 72/75 (96%) Frame = +1 Query: 19 HDSDKNIDEIMLPGFRFHPTDEELVEFYLKRKLQHRSLPIELIKQVDIYKYDPWDLPKLA 198 +D+DK +D++MLPGFRFHPTDEELV FYLKRK+Q RSLPIELIKQVDIYKYDPWDLPKLA Sbjct: 5 NDTDK-MDDVMLPGFRFHPTDEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLPKLA 63 Query: 199 STGEKEWYFYCPRDR 243 +TGEKEWYFYCPRDR Sbjct: 64 TTGEKEWYFYCPRDR 78 >emb|CBI22222.3| unnamed protein product [Vitis vinifera] Length = 353 Score = 144 bits (363), Expect = 7e-33 Identities = 65/75 (86%), Positives = 72/75 (96%) Frame = +1 Query: 19 HDSDKNIDEIMLPGFRFHPTDEELVEFYLKRKLQHRSLPIELIKQVDIYKYDPWDLPKLA 198 +D+DK +D++MLPGFRFHPTDEELV FYLKRK+Q RSLPIELIKQVDIYKYDPWDLPKLA Sbjct: 5 NDTDK-MDDVMLPGFRFHPTDEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLPKLA 63 Query: 199 STGEKEWYFYCPRDR 243 +TGEKEWYFYCPRDR Sbjct: 64 TTGEKEWYFYCPRDR 78