BLASTX nr result
ID: Scutellaria22_contig00027131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027131 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142061.1| PREDICTED: hsp70-binding protein 1-like [Cuc... 119 2e-25 ref|XP_002269511.1| PREDICTED: hsp70-binding protein 1-like [Vit... 118 4e-25 ref|XP_002531556.1| Hsp70-binding protein, putative [Ricinus com... 117 7e-25 ref|XP_002308167.1| predicted protein [Populus trichocarpa] gi|2... 117 1e-24 ref|XP_003516899.1| PREDICTED: hsp70-binding protein 1-like [Gly... 110 1e-22 >ref|XP_004142061.1| PREDICTED: hsp70-binding protein 1-like [Cucumis sativus] gi|449515169|ref|XP_004164622.1| PREDICTED: hsp70-binding protein 1-like [Cucumis sativus] Length = 397 Score = 119 bits (299), Expect = 2e-25 Identities = 56/75 (74%), Positives = 63/75 (84%) Frame = -1 Query: 415 RIKVIGEMSAEDLGAAREERQLVDTLWNTCLNEPSPLREQGLLVLPGEDAPPPDVASQHF 236 RIK I +S EDLGAA+EERQLVD+LWNTC EPS LRE+GLLVLPGEDAPPPDVAS+HF Sbjct: 279 RIKEISLLSPEDLGAAKEERQLVDSLWNTCYKEPSSLREKGLLVLPGEDAPPPDVASKHF 338 Query: 235 QPPLRAWAANRNPDT 191 +PPLRAW+ DT Sbjct: 339 EPPLRAWSGRPPADT 353 >ref|XP_002269511.1| PREDICTED: hsp70-binding protein 1-like [Vitis vinifera] Length = 396 Score = 118 bits (296), Expect = 4e-25 Identities = 55/71 (77%), Positives = 62/71 (87%) Frame = -1 Query: 415 RIKVIGEMSAEDLGAAREERQLVDTLWNTCLNEPSPLREQGLLVLPGEDAPPPDVASQHF 236 RIK I MS EDLGAAREER LVD+LWN C NEPS LR +GL+VLPG+DAPPPDVAS+HF Sbjct: 279 RIKGISLMSPEDLGAAREERHLVDSLWNACYNEPSSLRGEGLVVLPGDDAPPPDVASKHF 338 Query: 235 QPPLRAWAANR 203 +PPLRAWAAN+ Sbjct: 339 EPPLRAWAANQ 349 >ref|XP_002531556.1| Hsp70-binding protein, putative [Ricinus communis] gi|223528817|gb|EEF30822.1| Hsp70-binding protein, putative [Ricinus communis] Length = 359 Score = 117 bits (294), Expect = 7e-25 Identities = 56/70 (80%), Positives = 61/70 (87%) Frame = -1 Query: 415 RIKVIGEMSAEDLGAAREERQLVDTLWNTCLNEPSPLREQGLLVLPGEDAPPPDVASQHF 236 RIK I MS EDLGAAREER LVD+LWN C NEPS LRE+GLLVLPGED+ PPDVAS+HF Sbjct: 243 RIKGISLMSPEDLGAAREERHLVDSLWNACYNEPSSLREKGLLVLPGEDSLPPDVASKHF 302 Query: 235 QPPLRAWAAN 206 +PPLRAWAAN Sbjct: 303 EPPLRAWAAN 312 >ref|XP_002308167.1| predicted protein [Populus trichocarpa] gi|222854143|gb|EEE91690.1| predicted protein [Populus trichocarpa] Length = 370 Score = 117 bits (293), Expect = 1e-24 Identities = 56/75 (74%), Positives = 63/75 (84%), Gaps = 4/75 (5%) Frame = -1 Query: 403 IGEMSAEDLGAAREERQLVDTLWNTCLNEPSPLREQGLLVLPGEDAPPPDVASQHFQPPL 224 I MS EDLGAAREERQLVD+LWN C NEPS LR++GLLVLPGED+PPPDVAS+HF+PPL Sbjct: 283 ISLMSPEDLGAAREERQLVDSLWNACYNEPSSLRDKGLLVLPGEDSPPPDVASKHFEPPL 342 Query: 223 RAWA----ANRNPDT 191 RAWA A +NP T Sbjct: 343 RAWAARPDAGKNPGT 357 >ref|XP_003516899.1| PREDICTED: hsp70-binding protein 1-like [Glycine max] Length = 386 Score = 110 bits (275), Expect = 1e-22 Identities = 53/70 (75%), Positives = 59/70 (84%) Frame = -1 Query: 415 RIKVIGEMSAEDLGAAREERQLVDTLWNTCLNEPSPLREQGLLVLPGEDAPPPDVASQHF 236 RI I MSAEDLG REERQLVD+LW+TC NEPS LRE+GLLVLPGEDAPPPDVAS+ F Sbjct: 278 RINNISLMSAEDLGVVREERQLVDSLWSTCFNEPSSLREKGLLVLPGEDAPPPDVASKFF 337 Query: 235 QPPLRAWAAN 206 +PPLR+ AN Sbjct: 338 EPPLRSSTAN 347