BLASTX nr result
ID: Scutellaria22_contig00027081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00027081 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553291.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containi... 89 3e-16 ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. l... 84 1e-14 ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 emb|CBI15606.3| unnamed protein product [Vitis vinifera] 82 3e-14 >ref|XP_003553291.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Glycine max] Length = 732 Score = 90.5 bits (223), Expect = 1e-16 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 3/88 (3%) Frame = +3 Query: 9 HLTAQVLSAIIQNKPFNTFPPPKQHI---WTSGTVIQVLRSIPLYLFQSPRSIGRQKTFR 179 HL +Q L +I++ PF+ PPP WT+ V +VLR I Y QSPRSIGRQ TFR Sbjct: 299 HLASQTLVLVIKDLPFDAHPPPPSPSPPPWTNDAVTEVLRLISRYTLQSPRSIGRQHTFR 358 Query: 180 HRSPLKQRNLRHEAVKYKNGSLILGPAA 263 HR+PL+QRNL E K ++ +L+LGPAA Sbjct: 359 HRTPLRQRNLNLEHHKLRSNTLLLGPAA 386 >ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] gi|449518241|ref|XP_004166151.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Cucumis sativus] Length = 445 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/90 (48%), Positives = 60/90 (66%), Gaps = 6/90 (6%) Frame = +3 Query: 12 LTAQVLSAIIQNKPFNTF------PPPKQHIWTSGTVIQVLRSIPLYLFQSPRSIGRQKT 173 L Q+L A+++N+PF+T +W+S +V VLRS+P + FQS RSIG QK Sbjct: 14 LVDQILVAMLKNRPFDTHVHSAASTSTTHQLWSSDSVSDVLRSVPRFFFQSARSIGTQKG 73 Query: 174 FRHRSPLKQRNLRHEAVKYKNGSLILGPAA 263 FRHR+PLKQR L+ EA K++N L+LGP A Sbjct: 74 FRHRTPLKQRKLKEEAYKFRNNVLVLGPGA 103 >ref|XP_002887681.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297333522|gb|EFH63940.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 459 Score = 84.0 bits (206), Expect = 1e-14 Identities = 44/83 (53%), Positives = 57/83 (68%), Gaps = 2/83 (2%) Frame = +3 Query: 21 QVLSAIIQNKPFNTFPPPKQ--HIWTSGTVIQVLRSIPLYLFQSPRSIGRQKTFRHRSPL 194 Q+++A+IQN+PF+ + WT V VLRSIP + F SPRSIGRQK FRHRSPL Sbjct: 14 QLIAAMIQNRPFDAVLASSTVANPWTQQLVSDVLRSIPRFFFISPRSIGRQKGFRHRSPL 73 Query: 195 KQRNLRHEAVKYKNGSLILGPAA 263 KQRNL E+ + ++ L+LGP A Sbjct: 74 KQRNLSDESQRRRSEVLVLGPGA 96 >ref|XP_002279168.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Vitis vinifera] Length = 432 Score = 82.4 bits (202), Expect = 3e-14 Identities = 44/76 (57%), Positives = 52/76 (68%), Gaps = 1/76 (1%) Frame = +3 Query: 6 SHLTAQVLSAIIQNKPFNTFPPPK-QHIWTSGTVIQVLRSIPLYLFQSPRSIGRQKTFRH 182 S L QVL+A++QN P + P WT+ +V +VLRSIP FQSPRSIGRQK FRH Sbjct: 12 SSLVKQVLAAMVQNCPLDASPNKSCNQPWTTDSVSEVLRSIPRLFFQSPRSIGRQKGFRH 71 Query: 183 RSPLKQRNLRHEAVKY 230 RSPLKQRNL E K+ Sbjct: 72 RSPLKQRNLYQEPNKF 87 >emb|CBI15606.3| unnamed protein product [Vitis vinifera] Length = 381 Score = 82.4 bits (202), Expect = 3e-14 Identities = 44/76 (57%), Positives = 52/76 (68%), Gaps = 1/76 (1%) Frame = +3 Query: 6 SHLTAQVLSAIIQNKPFNTFPPPK-QHIWTSGTVIQVLRSIPLYLFQSPRSIGRQKTFRH 182 S L QVL+A++QN P + P WT+ +V +VLRSIP FQSPRSIGRQK FRH Sbjct: 12 SSLVKQVLAAMVQNCPLDASPNKSCNQPWTTDSVSEVLRSIPRLFFQSPRSIGRQKGFRH 71 Query: 183 RSPLKQRNLRHEAVKY 230 RSPLKQRNL E K+ Sbjct: 72 RSPLKQRNLYQEPNKF 87