BLASTX nr result
ID: Scutellaria22_contig00025449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025449 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36825.3| unnamed protein product [Vitis vinifera] 182 3e-44 ref|XP_002263353.1| PREDICTED: putative indole-3-acetic acid-ami... 182 3e-44 ref|XP_002531876.1| Indole-3-acetic acid-amido synthetase GH3.17... 169 3e-40 ref|XP_003518956.1| PREDICTED: putative indole-3-acetic acid-ami... 168 5e-40 dbj|BAJ33847.1| unnamed protein product [Thellungiella halophila] 166 2e-39 >emb|CBI36825.3| unnamed protein product [Vitis vinifera] Length = 548 Score = 182 bits (461), Expect = 3e-44 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 2/122 (1%) Frame = -3 Query: 457 HADTSSIPGHYVIYWEINDVIKPHAP--PLSAEVLEECCIAVEEGLDYVYRRCRTNDKSI 284 +ADTSS+PGHYV+YWEI I +P PL ++VLEECCIAVEE LDY+YRRCRT+DKS+ Sbjct: 426 YADTSSLPGHYVLYWEITHCISTDSPSTPLDSKVLEECCIAVEEELDYIYRRCRTHDKSV 485 Query: 283 GPLEIKVVKAGTFEKLMDLFIAQGGASINQYKTPRCVKSKSALKLLNANVSRCYFSPRYP 104 GPLEI++V+ GTFE LMDLFI+QGG SINQYKTPRC+KS +ALKLLN+NV +FSPR P Sbjct: 486 GPLEIRLVQPGTFEDLMDLFISQGG-SINQYKTPRCIKSSNALKLLNSNVEASFFSPRDP 544 Query: 103 AW 98 W Sbjct: 545 RW 546 >ref|XP_002263353.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 [Vitis vinifera] Length = 596 Score = 182 bits (461), Expect = 3e-44 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 2/122 (1%) Frame = -3 Query: 457 HADTSSIPGHYVIYWEINDVIKPHAP--PLSAEVLEECCIAVEEGLDYVYRRCRTNDKSI 284 +ADTSS+PGHYV+YWEI I +P PL ++VLEECCIAVEE LDY+YRRCRT+DKS+ Sbjct: 474 YADTSSLPGHYVLYWEITHCISTDSPSTPLDSKVLEECCIAVEEELDYIYRRCRTHDKSV 533 Query: 283 GPLEIKVVKAGTFEKLMDLFIAQGGASINQYKTPRCVKSKSALKLLNANVSRCYFSPRYP 104 GPLEI++V+ GTFE LMDLFI+QGG SINQYKTPRC+KS +ALKLLN+NV +FSPR P Sbjct: 534 GPLEIRLVQPGTFEDLMDLFISQGG-SINQYKTPRCIKSSNALKLLNSNVEASFFSPRDP 592 Query: 103 AW 98 W Sbjct: 593 RW 594 >ref|XP_002531876.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus communis] gi|223528484|gb|EEF30513.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus communis] Length = 597 Score = 169 bits (427), Expect = 3e-40 Identities = 81/123 (65%), Positives = 98/123 (79%), Gaps = 3/123 (2%) Frame = -3 Query: 457 HADTSSIPGHYVIYWEI---NDVIKPHAPPLSAEVLEECCIAVEEGLDYVYRRCRTNDKS 287 +A+T +PGHYV+YWEI + V+ + PL AEV +ECCIAVEE LDY+YRRCRT+DKS Sbjct: 474 YAETLVVPGHYVLYWEILHHSSVVNHNQTPLDAEVFQECCIAVEEELDYIYRRCRTHDKS 533 Query: 286 IGPLEIKVVKAGTFEKLMDLFIAQGGASINQYKTPRCVKSKSALKLLNANVSRCYFSPRY 107 IGPLEI+VV+ GTFE LMDLFI QGG SINQYKTPRC+KS +AL LLN++V +FS R Sbjct: 534 IGPLEIRVVEPGTFEALMDLFIGQGG-SINQYKTPRCIKSNAALMLLNSHVKASFFSARD 592 Query: 106 PAW 98 P W Sbjct: 593 PVW 595 >ref|XP_003518956.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like [Glycine max] Length = 606 Score = 168 bits (425), Expect = 5e-40 Identities = 85/124 (68%), Positives = 98/124 (79%), Gaps = 4/124 (3%) Frame = -3 Query: 457 HADTSSIPGHYVIYWEINDV-IKPHAPP---LSAEVLEECCIAVEEGLDYVYRRCRTNDK 290 + DTSS+PGHYV+YWEI IK + P L A VLEECCIAVEE LDYVYRRCR+ DK Sbjct: 477 YPDTSSVPGHYVLYWEILHCGIKTESSPQLQLDANVLEECCIAVEEQLDYVYRRCRSYDK 536 Query: 289 SIGPLEIKVVKAGTFEKLMDLFIAQGGASINQYKTPRCVKSKSALKLLNANVSRCYFSPR 110 S+GPLEI+VV+ GTF+ LMDLFI Q GASINQYKTPRC+KSK ALKLL + V+ +FSPR Sbjct: 537 SVGPLEIRVVEPGTFDALMDLFICQ-GASINQYKTPRCIKSKKALKLLKSKVTASFFSPR 595 Query: 109 YPAW 98 P W Sbjct: 596 DPKW 599 >dbj|BAJ33847.1| unnamed protein product [Thellungiella halophila] Length = 392 Score = 166 bits (419), Expect = 2e-39 Identities = 81/122 (66%), Positives = 99/122 (81%), Gaps = 1/122 (0%) Frame = -3 Query: 457 HADTSSIPGHYVIYWEINDVIKPHAPPLSAEVLEECCIAVEEGLDYVYRRCRTNDKSIGP 278 +ADTSS+PGHYV++WEI + H L +EECCIAVEE LDY+YR+CRT ++SIGP Sbjct: 275 YADTSSVPGHYVLFWEIQGLEPDHQQKL----MEECCIAVEEELDYIYRQCRTKERSIGP 330 Query: 277 LEIKVVKAGTFEKLMDLFIAQGGASINQYKTPRCVKSKSA-LKLLNANVSRCYFSPRYPA 101 LEI+VV+ GTFEKLMDL I+QGG S NQYKTPRCVKS SA L+LLNA+V+ +FSPRYP Sbjct: 331 LEIRVVEPGTFEKLMDLIISQGG-SFNQYKTPRCVKSDSATLELLNAHVTASFFSPRYPT 389 Query: 100 WN 95 W+ Sbjct: 390 WS 391