BLASTX nr result
ID: Scutellaria22_contig00025427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025427 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica] 63 3e-08 ref|NP_001234604.1| beta-amyrin synthase [Solanum lycopersicum] ... 62 5e-08 sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=... 62 6e-08 sp|A8CDT3.1|LUPS_BRUGY RecName: Full=Lupeol synthase; Short=BgLU... 61 8e-08 sp|B9X0J1.1|STBOS_STERE RecName: Full=Baccharis oxide synthase; ... 61 1e-07 >gb|ABK76265.1| beta-amyrin synthase [Vaccaria hispanica] Length = 760 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 113 MWRLKIAEGVDTPYLYSTNNYVGRQTWEFD 202 MWRLKIAEG + PYLYSTNN+VGRQTWEFD Sbjct: 1 MWRLKIAEGANDPYLYSTNNFVGRQTWEFD 30 >ref|NP_001234604.1| beta-amyrin synthase [Solanum lycopersicum] gi|357580425|sp|E7DN63.1|BAMS_SOLLC RecName: Full=Beta-amyrin synthase; AltName: Full=Triterpenoid synthase 1; Short=SlTTS1 gi|315613943|gb|ADU52574.1| beta-amyrin synthase [Solanum lycopersicum] Length = 761 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 113 MWRLKIAEGVDTPYLYSTNNYVGRQTWEFD 202 MW+LKIAEG + PYLYSTNNYVGRQTWEFD Sbjct: 1 MWKLKIAEGQNGPYLYSTNNYVGRQTWEFD 30 >sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS gi|157679391|dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza] Length = 759 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 113 MWRLKIAEGVDTPYLYSTNNYVGRQTWEFD 202 MWR+KIAEG PYLYSTNNYVGRQTWEFD Sbjct: 1 MWRIKIAEGGKDPYLYSTNNYVGRQTWEFD 30 >sp|A8CDT3.1|LUPS_BRUGY RecName: Full=Lupeol synthase; Short=BgLUS gi|157679393|dbj|BAF80444.1| lupeol synthase [Bruguiera gymnorhiza] Length = 761 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 113 MWRLKIAEGVDTPYLYSTNNYVGRQTWEFD 202 MWRLKIAEG + PY+YSTNN+VGRQTWEFD Sbjct: 1 MWRLKIAEGGNNPYIYSTNNFVGRQTWEFD 30 >sp|B9X0J1.1|STBOS_STERE RecName: Full=Baccharis oxide synthase; Short=StrBOS gi|224228177|dbj|BAH23676.1| baccharis oxide synthase [Stevia rebaudiana] Length = 761 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 113 MWRLKIAEGVDTPYLYSTNNYVGRQTWEFD 202 MWRLKIA+G + PYLYSTNN+VGRQTWEFD Sbjct: 1 MWRLKIADGNNNPYLYSTNNFVGRQTWEFD 30