BLASTX nr result
ID: Scutellaria22_contig00025059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00025059 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307592.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002520717.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 gb|AAQ56281.1| ethylene receptor [Litchi chinensis] 55 5e-06 >ref|XP_002307592.1| predicted protein [Populus trichocarpa] gi|222857041|gb|EEE94588.1| predicted protein [Populus trichocarpa] Length = 246 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = -2 Query: 120 THPE--NDAVSAASVAVPTYSPDPFIDFRRSMQEMVEARDI 4 THP+ SVAVPTYSPDP++DFRRSMQEMVEARD+ Sbjct: 138 THPQLLKSPTVKDSVAVPTYSPDPYMDFRRSMQEMVEARDL 178 >ref|XP_002520717.1| conserved hypothetical protein [Ricinus communis] gi|223540102|gb|EEF41679.1| conserved hypothetical protein [Ricinus communis] Length = 211 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -2 Query: 87 SVAVPTYSPDPFIDFRRSMQEMVEARD 7 SVAVPTYSPDP++DFRRSMQEMVEARD Sbjct: 131 SVAVPTYSPDPYLDFRRSMQEMVEARD 157 >gb|AAQ56281.1| ethylene receptor [Litchi chinensis] Length = 615 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -2 Query: 87 SVAVPTYSPDPFIDFRRSMQEMVEARDI 4 SVAVPTYSPDP++DFR+SMQEMVEARD+ Sbjct: 187 SVAVPTYSPDPYLDFRQSMQEMVEARDL 214