BLASTX nr result
ID: Scutellaria22_contig00024660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00024660 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521704.1| cyclin B, putative [Ricinus communis] gi|223... 62 4e-08 >ref|XP_002521704.1| cyclin B, putative [Ricinus communis] gi|223539095|gb|EEF40691.1| cyclin B, putative [Ricinus communis] Length = 432 Score = 62.4 bits (150), Expect = 4e-08 Identities = 36/67 (53%), Positives = 44/67 (65%), Gaps = 12/67 (17%) Frame = +3 Query: 138 MVISDENNLVQIRPSNVQGG-----RKFGAEIKPNRRALSVINHN-------HQCVVNKR 281 M +SDENN +PS+ QGG RKFG EI+ NRRAL+V+N N + CVVNKR Sbjct: 1 MNVSDENNPNIAKPSSFQGGLEMGNRKFGQEIRNNRRALNVLNQNFMGGQGAYPCVVNKR 60 Query: 282 GYSESNG 302 G SES+G Sbjct: 61 GLSESDG 67