BLASTX nr result
ID: Scutellaria22_contig00024596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00024596 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 60 3e-19 gb|EEC75928.1| hypothetical protein OsI_13019 [Oryza sativa Indi... 65 6e-09 ref|XP_002539361.1| conserved hypothetical protein [Ricinus comm... 47 9e-08 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 60.1 bits (144), Expect(2) = 3e-19 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 258 FQACSDIWFPRKIKLVSRVKGNLPARFGEH 347 FQACSDI FPRKIKLVSRV GNLPARFGEH Sbjct: 154 FQACSDIRFPRKIKLVSRVMGNLPARFGEH 183 Score = 59.7 bits (143), Expect(2) = 3e-19 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 124 QACTPYLRLLRQTVDSFMLEGEKGPKHGRCRPLEWQR 234 QACT LRLLRQ VDSF+ EG+KGPKH RCR LEWQR Sbjct: 112 QACT--LRLLRQAVDSFIREGKKGPKHLRCRTLEWQR 146 >gb|EEC75928.1| hypothetical protein OsI_13019 [Oryza sativa Indica Group] Length = 313 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 103 R*FTTEAKKRIDQEKGVLRALCPTHLTSSRGSPV 2 R TTEAKKR+DQEKGVLRALCPTHLTSSRGSPV Sbjct: 263 RFLTTEAKKRLDQEKGVLRALCPTHLTSSRGSPV 296 >ref|XP_002539361.1| conserved hypothetical protein [Ricinus communis] gi|223506854|gb|EEF23023.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 46.6 bits (109), Expect(2) = 9e-08 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 272 GHMVPAEDQVGEPCEGKPSRT 334 GH VPAEDQVGEPC+GKPSRT Sbjct: 20 GHTVPAEDQVGEPCDGKPSRT 40 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 391 GSSLDSQIGPTRNSLL 438 GSSLDSQIGPTRNSLL Sbjct: 41 GSSLDSQIGPTRNSLL 56