BLASTX nr result
ID: Scutellaria22_contig00024312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00024312 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 70 2e-10 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 69 3e-10 ref|NP_001117603.1| conserved peptide upstream open reading fram... 69 3e-10 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 60 1e-07 ref|NP_001119115.1| uncharacerized protein [Arabidopsis thaliana... 60 2e-07 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] Length = 41 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -3 Query: 224 MSPILSEILLSGFTIVSTLRRGSHLVQSFSVVFLYWFYVFS 102 MSP+LSEIL SGF I S+LRR +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 224 MSPILSEILLSGFTIVSTLRRGSHLVQSFSVVFLYWFYVFS 102 MSP++SEIL SG TI S+LRR +HLVQSFSVVFLYWFYVFS Sbjct: 13 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 224 MSPILSEILLSGFTIVSTLRRGSHLVQSFSVVFLYWFYVFS 102 MSP++SEIL SG TI S+LRR +HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein [Arabidopsis thaliana] Length = 41 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 224 MSPILSEILLSGFTIVSTLRRGSHLVQSFSVVFLYWFY 111 M+P+L EILLSG T+ S L R +HLVQSFSVVFLYWFY Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFY 38 >ref|NP_001119115.1| uncharacerized protein [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| uncharacerized protein [Arabidopsis thaliana] Length = 42 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -3 Query: 224 MSPI-LSEILLSGFTIVSTLRRGSHLVQSFSVVFLYWFYVFS 102 MSPI LSEI LSGF + ST+RR +HLVQSFSVVFLYW Y S Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42