BLASTX nr result
ID: Scutellaria22_contig00023967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00023967 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding sub... 63 4e-10 gb|ABD33126.2| RNA-directed DNA polymerase (Reverse transcriptas... 67 2e-09 ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [S... 65 6e-09 ref|XP_003604260.1| CNGC5-like protein [Medicago truncatula] gi|... 65 7e-09 gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptas... 65 7e-09 >ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] gi|355513943|gb|AES95566.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula] Length = 1723 Score = 63.2 bits (152), Expect(2) = 4e-10 Identities = 31/62 (50%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -3 Query: 377 GRYIQNL--MFMQSLSFPEALNDTKVVLIPKCENRATLEDLRPISLCYVLYKIISKVLAD 204 GRYI ++ + SFP LN T + LIPK + +++++D RPI+LC VLYKI++KVLA+ Sbjct: 902 GRYIFEAACFWLDNGSFPSCLNSTNITLIPKGDTQSSMKDWRPIALCNVLYKIVAKVLAN 961 Query: 203 RL 198 RL Sbjct: 962 RL 963 Score = 25.8 bits (55), Expect(2) = 4e-10 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -2 Query: 141 IQYILKTCDRFAWEYL-GIVGK 79 IQYI DR WEYL I+GK Sbjct: 998 IQYISTAYDRINWEYLRSIMGK 1019 >gb|ABD33126.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 653 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/51 (58%), Positives = 41/51 (80%) Frame = -3 Query: 338 SFPEALNDTKVVLIPKCENRATLEDLRPISLCYVLYKIISKVLADRLIKLL 186 + P AL DT +VLIPKC++ T+ DLRPISLC V+YKI++K LA+RL ++L Sbjct: 71 NLPTALGDTNIVLIPKCDHPRTMRDLRPISLCNVVYKILAKTLANRLQRVL 121 >ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor] gi|241926916|gb|EES00061.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor] Length = 631 Score = 65.1 bits (157), Expect = 6e-09 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -3 Query: 332 PEALNDTKVVLIPKCENRATLEDLRPISLCYVLYKIISKVLADRLIKLL 186 PE NDT +VLIPK L+DLRPISLC VLYK+ISKVLA+RL K+L Sbjct: 62 PEGWNDTIIVLIPKTNTPQMLKDLRPISLCNVLYKLISKVLANRLKKIL 110 >ref|XP_003604260.1| CNGC5-like protein [Medicago truncatula] gi|355505315|gb|AES86457.1| CNGC5-like protein [Medicago truncatula] Length = 1023 Score = 64.7 bits (156), Expect = 7e-09 Identities = 27/46 (58%), Positives = 40/46 (86%) Frame = -3 Query: 335 FPEALNDTKVVLIPKCENRATLEDLRPISLCYVLYKIISKVLADRL 198 FP +LN+T + LIPKC++ +++D+RPISLC VLYK++SK+LA+RL Sbjct: 85 FPSSLNETNICLIPKCDSPKSMKDMRPISLCNVLYKMLSKLLANRL 130 >gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 573 Score = 64.7 bits (156), Expect = 7e-09 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = -3 Query: 353 FMQSLSFPEALNDTKVVLIPKCENRATLEDLRPISLCYVLYKIISKVLADRLIKLL 186 ++ S SFP LN T +VL PK +N ++DLRPISLC VLYKIISKVLA+RL L+ Sbjct: 34 WLTSGSFPPELNATHIVLAPKGDNPEYMKDLRPISLCNVLYKIISKVLANRLRPLI 89