BLASTX nr result
ID: Scutellaria22_contig00023939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00023939 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 96 2e-21 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 74 1e-11 ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002529560.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 95.9 bits (237), Expect(2) = 2e-21 Identities = 44/47 (93%), Positives = 44/47 (93%) Frame = +3 Query: 264 HRGVVARVSRPGILHLAFMISTFNCAPETRSKHARPVCFFHDML*SW 404 H GVVARVSRPGILHLAFMISTF CAPETRSKHARPVCFFHDML SW Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWSW 799 Score = 31.6 bits (70), Expect(2) = 2e-21 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 229 GRRGPGCASDWHIG 270 GRRGPGCASD H+G Sbjct: 742 GRRGPGCASDRHMG 755 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = +3 Query: 318 MISTFNCAPETRSKHARPVCFFHDML*SWVSFSGLLALE 434 MISTFNCAPETRSKHARPVCFFHDML S VS SGLLALE Sbjct: 1 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSSGLLALE 39 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 435 ILRLEDH*KTPRTRACRERSTLGGRASTVSPGHS 334 +L LEDH P TRACRERSTLGGRASTVSPGHS Sbjct: 61 LLTLEDHRNIPGTRACRERSTLGGRASTVSPGHS 94 >ref|XP_002529560.1| conserved hypothetical protein [Ricinus communis] gi|223530972|gb|EEF32829.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 426 LEDH*KTPRTRACRERSTLGGRASTVSPGHS 334 +EDH P TRACRERSTLGGRASTVSPGHS Sbjct: 63 VEDHRNIPGTRACRERSTLGGRASTVSPGHS 93