BLASTX nr result
ID: Scutellaria22_contig00023803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00023803 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517471.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 ref|NP_001234211.1| auxin efflux facilitator SlPIN8 [Solanum lyc... 61 8e-08 ref|XP_003552512.1| PREDICTED: probable auxin efflux carrier com... 57 1e-06 ref|XP_003534463.1| PREDICTED: auxin efflux carrier component 1-... 57 1e-06 ref|XP_004147461.1| PREDICTED: probable auxin efflux carrier com... 55 8e-06 >ref|XP_002517471.1| conserved hypothetical protein [Ricinus communis] gi|223543482|gb|EEF45013.1| conserved hypothetical protein [Ricinus communis] Length = 313 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 125 TKNQRTRSIQIILLTVGKKLMRNPNTHATLLGIIWASIHFR 3 T R +ILLTVGKKL+RNPN HATLLG+IWAS+HFR Sbjct: 145 TSTTRRAKTMVILLTVGKKLLRNPNFHATLLGLIWASVHFR 185 >ref|NP_001234211.1| auxin efflux facilitator SlPIN8 [Solanum lycopersicum] gi|312983238|gb|ADR30415.1| auxin efflux facilitator SlPIN8 [Solanum lycopersicum] Length = 357 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 113 RTRSIQIILLTVGKKLMRNPNTHATLLGIIWASIHFR 3 R ++I +ILLTVG+KL+ NPNTHATL GIIW+SIHFR Sbjct: 193 RKKTIMVILLTVGRKLIINPNTHATLAGIIWSSIHFR 229 >ref|XP_003552512.1| PREDICTED: probable auxin efflux carrier component 1b-like [Glycine max] Length = 359 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 116 QRTRSIQIILLTVGKKLMRNPNTHATLLGIIWASIHFR 3 +R + +IL+TVGKKL+RNPNT+ATLLG IW+SI FR Sbjct: 194 KRKMKVMLILVTVGKKLIRNPNTYATLLGFIWSSIQFR 231 >ref|XP_003534463.1| PREDICTED: auxin efflux carrier component 1-like [Glycine max] Length = 358 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = -1 Query: 116 QRTRSIQIILLTVGKKLMRNPNTHATLLGIIWASIHFR 3 +R R + +IL+TVGKKL++NPNT+ATLLG IW+SI FR Sbjct: 193 KRKRKVLLILVTVGKKLIKNPNTYATLLGFIWSSIKFR 230 >ref|XP_004147461.1| PREDICTED: probable auxin efflux carrier component 1b-like [Cucumis sativus] gi|449523229|ref|XP_004168626.1| PREDICTED: probable auxin efflux carrier component 1b-like [Cucumis sativus] Length = 357 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 122 KNQRTRSIQIILLTVGKKLMRNPNTHATLLGIIWASIHFR 3 +N R+ + ILLTV +KL+ NPNTHAT+LG+IWASI FR Sbjct: 190 RNGRSLRTKSILLTVARKLIINPNTHATILGLIWASIRFR 229