BLASTX nr result
ID: Scutellaria22_contig00023408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00023408 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518605.1| PREDICTED: uncharacterized protein LOC100803... 90 2e-16 ref|XP_003535995.1| PREDICTED: uncharacterized protein LOC100803... 88 6e-16 ref|XP_002281632.1| PREDICTED: uncharacterized protein LOC100255... 88 8e-16 emb|CBI37065.3| unnamed protein product [Vitis vinifera] 88 8e-16 emb|CAN67131.1| hypothetical protein VITISV_040172 [Vitis vinifera] 88 8e-16 >ref|XP_003518605.1| PREDICTED: uncharacterized protein LOC100803234 [Glycine max] Length = 494 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +1 Query: 1 LYFYQDPGSTPARRIWTSLDVGTEIFVSDRDEEAEWTLSDFDVILT 138 LYFYQDPG+ PA+RIWTS+D GTEIFVSD+DEEAEWTLSDFDVILT Sbjct: 435 LYFYQDPGTPPAKRIWTSIDSGTEIFVSDKDEEAEWTLSDFDVILT 480 >ref|XP_003535995.1| PREDICTED: uncharacterized protein LOC100803952 [Glycine max] Length = 496 Score = 88.2 bits (217), Expect = 6e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = +1 Query: 1 LYFYQDPGSTPARRIWTSLDVGTEIFVSDRDEEAEWTLSDFDVILT 138 LYFYQDPG++PA+RIWTS+D GTEIFVSD+DE AEWTLSDFDVILT Sbjct: 437 LYFYQDPGTSPAKRIWTSIDSGTEIFVSDKDEVAEWTLSDFDVILT 482 >ref|XP_002281632.1| PREDICTED: uncharacterized protein LOC100255480 isoform 1 [Vitis vinifera] Length = 491 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +1 Query: 1 LYFYQDPGSTPARRIWTSLDVGTEIFVSDRDEEAEWTLSDFDVILT 138 LYFYQDPG++PARRIWTS+D+GTEIFV+D++E AEWTLSDFDVILT Sbjct: 442 LYFYQDPGTSPARRIWTSIDMGTEIFVTDKEEVAEWTLSDFDVILT 487 >emb|CBI37065.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +1 Query: 1 LYFYQDPGSTPARRIWTSLDVGTEIFVSDRDEEAEWTLSDFDVILT 138 LYFYQDPG++PARRIWTS+D+GTEIFV+D++E AEWTLSDFDVILT Sbjct: 400 LYFYQDPGTSPARRIWTSIDMGTEIFVTDKEEVAEWTLSDFDVILT 445 >emb|CAN67131.1| hypothetical protein VITISV_040172 [Vitis vinifera] Length = 457 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/46 (82%), Positives = 45/46 (97%) Frame = +1 Query: 1 LYFYQDPGSTPARRIWTSLDVGTEIFVSDRDEEAEWTLSDFDVILT 138 LYFYQDPG++PARRIWTS+D+GTEIFV+D++E AEWTLSDFDVILT Sbjct: 408 LYFYQDPGTSPARRIWTSIDMGTEIFVTDKEEVAEWTLSDFDVILT 453