BLASTX nr result
ID: Scutellaria22_contig00023292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00023292 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155408.1| PREDICTED: AP-1 complex subunit mu-1-like, p... 72 4e-11 ref|XP_004135264.1| PREDICTED: AP-1 complex subunit mu-1-like [C... 72 4e-11 ref|NP_176277.1| AP-1 complex subunit mu [Arabidopsis thaliana] ... 72 4e-11 gb|AFW83687.1| hypothetical protein ZEAMMB73_283352 [Zea mays] 72 4e-11 gb|AFW83685.1| hypothetical protein ZEAMMB73_283352 [Zea mays] 72 4e-11 >ref|XP_004155408.1| PREDICTED: AP-1 complex subunit mu-1-like, partial [Cucumis sativus] Length = 428 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 104 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE Sbjct: 391 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 424 >ref|XP_004135264.1| PREDICTED: AP-1 complex subunit mu-1-like [Cucumis sativus] Length = 428 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 104 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE Sbjct: 391 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 424 >ref|NP_176277.1| AP-1 complex subunit mu [Arabidopsis thaliana] gi|2462748|gb|AAB71967.1| putative Clathrin Coat Assembly protein [Arabidopsis thaliana] gi|20466372|gb|AAM20503.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis thaliana] gi|25084014|gb|AAN72155.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis thaliana] gi|332195610|gb|AEE33731.1| AP-1 complex subunit mu [Arabidopsis thaliana] Length = 428 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 104 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE Sbjct: 391 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 424 >gb|AFW83687.1| hypothetical protein ZEAMMB73_283352 [Zea mays] Length = 227 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 104 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE Sbjct: 190 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 223 >gb|AFW83685.1| hypothetical protein ZEAMMB73_283352 [Zea mays] Length = 632 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 3 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 104 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE Sbjct: 595 TVSGIQVRYLKIIEKSGYQALPWVRYITMAGEYE 628