BLASTX nr result
ID: Scutellaria22_contig00019459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00019459 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [V... 98 6e-19 ref|XP_002509935.1| amino acid transporter, putative [Ricinus co... 98 8e-19 gb|AAM63237.1| amino acid permease-like protein [Arabidopsis tha... 97 1e-18 ref|NP_568597.1| Transmembrane amino acid transporter family pro... 97 1e-18 dbj|BAB10655.1| amino acid permease-like protein; proline transp... 97 1e-18 >ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera] gi|297742313|emb|CBI34462.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 98.2 bits (243), Expect = 6e-19 Identities = 49/58 (84%), Positives = 51/58 (87%) Frame = -1 Query: 224 FVLPMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 51 F+LPMLLYNMTHKP RSS+ YWIN SIIIVFT GIMGAFSSIRKL LDA KFKLFSS Sbjct: 394 FILPMLLYNMTHKPPRSSLMYWINISIIIVFTDAGIMGAFSSIRKLILDAYKFKLFSS 451 >ref|XP_002509935.1| amino acid transporter, putative [Ricinus communis] gi|223549834|gb|EEF51322.1| amino acid transporter, putative [Ricinus communis] Length = 452 Score = 97.8 bits (242), Expect = 8e-19 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -1 Query: 224 FVLPMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 51 FVLPMLLYNMT+KP RSS+ YWIN SII+VFT GIMGAFSSIRKL LDA+KFKLFSS Sbjct: 391 FVLPMLLYNMTYKPRRSSLTYWINISIIVVFTGAGIMGAFSSIRKLVLDAKKFKLFSS 448 >gb|AAM63237.1| amino acid permease-like protein [Arabidopsis thaliana] Length = 452 Score = 97.1 bits (240), Expect = 1e-18 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 224 FVLPMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 51 FVLPMLLYNMT+KP R S YWIN +I++VFTC G+MGAFSSIRKL LDA KFKLFSS Sbjct: 391 FVLPMLLYNMTYKPTRRSFTYWINMTIMVVFTCAGLMGAFSSIRKLVLDANKFKLFSS 448 >ref|NP_568597.1| Transmembrane amino acid transporter family protein [Arabidopsis thaliana] gi|75245603|sp|Q8L4X4.1|GAT2_ARATH RecName: Full=Probable GABA transporter 2 gi|20466438|gb|AAM20536.1| amino acid permease-like protein [Arabidopsis thaliana] gi|22136372|gb|AAM91264.1| amino acid permease-like protein [Arabidopsis thaliana] gi|332007347|gb|AED94730.1| Transmembrane amino acid transporter family protein [Arabidopsis thaliana] Length = 452 Score = 97.1 bits (240), Expect = 1e-18 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 224 FVLPMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 51 FVLPMLLYNMT+KP R S YWIN +I++VFTC G+MGAFSSIRKL LDA KFKLFSS Sbjct: 391 FVLPMLLYNMTYKPTRRSFTYWINMTIMVVFTCAGLMGAFSSIRKLVLDANKFKLFSS 448 >dbj|BAB10655.1| amino acid permease-like protein; proline transporter-like protein [Arabidopsis thaliana] Length = 423 Score = 97.1 bits (240), Expect = 1e-18 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 224 FVLPMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 51 FVLPMLLYNMT+KP R S YWIN +I++VFTC G+MGAFSSIRKL LDA KFKLFSS Sbjct: 362 FVLPMLLYNMTYKPTRRSFTYWINMTIMVVFTCAGLMGAFSSIRKLVLDANKFKLFSS 419