BLASTX nr result
ID: Scutellaria22_contig00019439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00019439 (499 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267589.1| PREDICTED: uncharacterized protein LOC100245... 64 2e-08 ref|XP_002512992.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002267589.1| PREDICTED: uncharacterized protein LOC100245210 [Vitis vinifera] gi|297744730|emb|CBI37992.3| unnamed protein product [Vitis vinifera] Length = 260 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +1 Query: 280 SVEPWQDEATLSQEDIAWADSCLTKDPEMLDSGWHSLKAALLETLDGQDHS 432 S+E QD +LS ED+AW DSCL KDPE+ DS W+SLK ALLE L+ Q ++ Sbjct: 43 SLESSQDAGSLSPEDVAWVDSCLIKDPEVSDSDWNSLKDALLEILNVQPNA 93 >ref|XP_002512992.1| conserved hypothetical protein [Ricinus communis] gi|223548003|gb|EEF49495.1| conserved hypothetical protein [Ricinus communis] Length = 250 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = +1 Query: 280 SVEPWQDEATLSQEDIAWADSCLTKDPEMLDSGWHSLKAALLET--LDGQDHSSLYERDN 453 S++ Q++ LS E+IAW DSCL KDP+ D W S+K ALL+ L + H+SL + Sbjct: 19 SLKSNQNDDALSPEEIAWVDSCLVKDPDTSDDDWSSMKDALLDILGLQAESHNSLAPESD 78 Query: 454 SLEE 465 L + Sbjct: 79 GLSK 82