BLASTX nr result
ID: Scutellaria22_contig00019366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00019366 (539 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM64610.1| DNA binding protein TGA1a homolog [Arabidopsis th... 73 3e-11 ref|NP_201324.1| transcription factor TGA1 [Arabidopsis thaliana... 73 3e-11 dbj|BAH20132.1| AT5G65210 [Arabidopsis thaliana] 73 3e-11 ref|NP_001078800.1| transcription factor TGA1 [Arabidopsis thali... 73 3e-11 emb|CAA48189.1| transcription factor [Arabidopsis thaliana] 73 3e-11 >gb|AAM64610.1| DNA binding protein TGA1a homolog [Arabidopsis thaliana] Length = 344 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 524 SSIDMLKSLVRFVGQADHLRQETLQQMLKILTTRQAARGLLALGEY 387 S++D L++LV FV QADHLR ETLQQM +ILTTRQAARGLLALGEY Sbjct: 280 SAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEY 325 >ref|NP_201324.1| transcription factor TGA1 [Arabidopsis thaliana] gi|30698106|ref|NP_851273.1| transcription factor TGA1 [Arabidopsis thaliana] gi|79332347|ref|NP_001032147.1| transcription factor TGA1 [Arabidopsis thaliana] gi|79332369|ref|NP_001032148.1| transcription factor TGA1 [Arabidopsis thaliana] gi|79332396|ref|NP_001032149.1| transcription factor TGA1 [Arabidopsis thaliana] gi|44888359|sp|Q39237.2|TGA1_ARATH RecName: Full=Transcription factor TGA1; AltName: Full=DNA-binding protein TGA1a-like protein; AltName: Full=bZIP transcription factor 47; Short=AtbZIP47 gi|10178183|dbj|BAB11657.1| DNA binding protein TGA1a homolog [Arabidopsis thaliana] gi|20466254|gb|AAM20444.1| DNA binding protein TGA1a-like protein [Arabidopsis thaliana] gi|22136320|gb|AAM91238.1| DNA binding protein TGA1a-like protein [Arabidopsis thaliana] gi|222423724|dbj|BAH19828.1| AT5G65210 [Arabidopsis thaliana] gi|222424395|dbj|BAH20153.1| AT5G65210 [Arabidopsis thaliana] gi|332010636|gb|AED98019.1| transcription factor TGA1 [Arabidopsis thaliana] gi|332010637|gb|AED98020.1| transcription factor TGA1 [Arabidopsis thaliana] gi|332010638|gb|AED98021.1| transcription factor TGA1 [Arabidopsis thaliana] gi|332010639|gb|AED98022.1| transcription factor TGA1 [Arabidopsis thaliana] gi|332010640|gb|AED98023.1| transcription factor TGA1 [Arabidopsis thaliana] Length = 368 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 524 SSIDMLKSLVRFVGQADHLRQETLQQMLKILTTRQAARGLLALGEY 387 S++D L++LV FV QADHLR ETLQQM +ILTTRQAARGLLALGEY Sbjct: 304 SAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEY 349 >dbj|BAH20132.1| AT5G65210 [Arabidopsis thaliana] Length = 368 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 524 SSIDMLKSLVRFVGQADHLRQETLQQMLKILTTRQAARGLLALGEY 387 S++D L++LV FV QADHLR ETLQQM +ILTTRQAARGLLALGEY Sbjct: 304 SAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEY 349 >ref|NP_001078800.1| transcription factor TGA1 [Arabidopsis thaliana] gi|332010641|gb|AED98024.1| transcription factor TGA1 [Arabidopsis thaliana] Length = 298 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 524 SSIDMLKSLVRFVGQADHLRQETLQQMLKILTTRQAARGLLALGEY 387 S++D L++LV FV QADHLR ETLQQM +ILTTRQAARGLLALGEY Sbjct: 234 SAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEY 279 >emb|CAA48189.1| transcription factor [Arabidopsis thaliana] Length = 367 Score = 72.8 bits (177), Expect = 3e-11 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 524 SSIDMLKSLVRFVGQADHLRQETLQQMLKILTTRQAARGLLALGEY 387 S++D L++LV FV QADHLR ETLQQM +ILTTRQAARGLLALGEY Sbjct: 303 SAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEY 348