BLASTX nr result
ID: Scutellaria22_contig00019363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00019363 (637 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310515.1| predicted protein [Populus trichocarpa] gi|2... 84 2e-14 ref|XP_002307029.1| predicted protein [Populus trichocarpa] gi|2... 84 3e-14 ref|XP_002339432.1| predicted protein [Populus trichocarpa] gi|2... 80 4e-13 ref|XP_002511528.1| zinc finger protein, putative [Ricinus commu... 79 9e-13 ref|XP_002511529.1| zinc finger protein, putative [Ricinus commu... 77 4e-12 >ref|XP_002310515.1| predicted protein [Populus trichocarpa] gi|222853418|gb|EEE90965.1| predicted protein [Populus trichocarpa] Length = 231 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/64 (54%), Positives = 47/64 (73%) Frame = -1 Query: 193 IPSDDSSIQELVEKKVVMSTNSETCSICMEELPAGSEAVSMPCSHLFHQDCIVKWLRTSH 14 IP+ SSI L + S ++ C++CMEE+ AGSEA+ MPCSH++H DCIV+WL+TSH Sbjct: 158 IPATKSSIDALERVVLDASASARDCTVCMEEIDAGSEAIRMPCSHVYHSDCIVRWLQTSH 217 Query: 13 YCPL 2 CPL Sbjct: 218 MCPL 221 >ref|XP_002307029.1| predicted protein [Populus trichocarpa] gi|222856478|gb|EEE94025.1| predicted protein [Populus trichocarpa] Length = 246 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/66 (54%), Positives = 47/66 (71%) Frame = -1 Query: 199 GMIPSDDSSIQELVEKKVVMSTNSETCSICMEELPAGSEAVSMPCSHLFHQDCIVKWLRT 20 G IP+ SSI L S+++ C++CMEE+ AGSEA MPCSH++H DCIV+WL+T Sbjct: 154 GQIPATKSSIDALERVVFDGSSSTRDCTVCMEEIEAGSEATRMPCSHVYHSDCIVQWLQT 213 Query: 19 SHYCPL 2 SH CPL Sbjct: 214 SHLCPL 219 >ref|XP_002339432.1| predicted protein [Populus trichocarpa] gi|222875105|gb|EEF12236.1| predicted protein [Populus trichocarpa] Length = 188 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = -1 Query: 199 GMIPSDDSSIQELVEKKVVMSTNSETCSICMEELPAGSEAVSMPCSHLFHQDCIVKWLRT 20 G IP+ SSI L S+++ C++CME + AGSEA MPCSH++H DCIV+WLRT Sbjct: 96 GQIPATKSSIDALERVVFDGSSSTRDCTVCMEGIEAGSEATRMPCSHVYHSDCIVQWLRT 155 Query: 19 SHYCPL 2 S+ CPL Sbjct: 156 SYSCPL 161 >ref|XP_002511528.1| zinc finger protein, putative [Ricinus communis] gi|223550643|gb|EEF52130.1| zinc finger protein, putative [Ricinus communis] Length = 220 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/65 (50%), Positives = 43/65 (66%) Frame = -1 Query: 196 MIPSDDSSIQELVEKKVVMSTNSETCSICMEELPAGSEAVSMPCSHLFHQDCIVKWLRTS 17 +IP+ +SSI+ L N C+ICME++ AG EA+ MPCSH +H DCIV WLR Sbjct: 147 LIPAAESSIRALKRMVFDDLENLRECTICMEQIEAGMEAIQMPCSHFYHPDCIVSWLRNG 206 Query: 16 HYCPL 2 H+CPL Sbjct: 207 HFCPL 211 >ref|XP_002511529.1| zinc finger protein, putative [Ricinus communis] gi|223550644|gb|EEF52131.1| zinc finger protein, putative [Ricinus communis] Length = 249 Score = 76.6 bits (187), Expect = 4e-12 Identities = 33/65 (50%), Positives = 42/65 (64%) Frame = -1 Query: 196 MIPSDDSSIQELVEKKVVMSTNSETCSICMEELPAGSEAVSMPCSHLFHQDCIVKWLRTS 17 +IP+ SSI+ L N C+ICME++ AG EA+ MPCSH +H DCIV WLR Sbjct: 176 LIPAAVSSIRALKRMVFDDLENLRECTICMEQIEAGMEAIQMPCSHFYHPDCIVSWLRNG 235 Query: 16 HYCPL 2 H+CPL Sbjct: 236 HFCPL 240