BLASTX nr result
ID: Scutellaria22_contig00018961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00018961 (584 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_17273960.1| hypothetical protein HMPREF1070_02625 [Bacter... 59 6e-07 ref|ZP_04552731.1| predicted protein [Bacteroides sp. 2_2_4] gi|... 59 8e-07 >ref|ZP_17273960.1| hypothetical protein HMPREF1070_02625 [Bacteroides ovatus CL03T12C18] gi|392671561|gb|EIY65033.1| hypothetical protein HMPREF1070_02625 [Bacteroides ovatus CL03T12C18] Length = 444 Score = 58.9 bits (141), Expect = 6e-07 Identities = 43/137 (31%), Positives = 68/137 (49%), Gaps = 2/137 (1%) Frame = +2 Query: 5 NSRFSRRTDQGGDSNTPRRTTMGSDFSRNNRNHGRGSDEKNSSRFSRTDVRGGDSNTPRR 184 NS + + G + T R D++R++ N S S R + T R + T Sbjct: 283 NSSVGQSVRRSGSTGTNSRVVGTRDYTRSSSNSSVRSGSSYSRRNTETYTRPSSTRTSGT 342 Query: 185 TTMNSDFSRNRTNR--RGTEDNVSQNSSRFSRRSDVERSDSYIPRRTGRKSDSYGNGARS 358 +T NS S NR+N R + N S++SS +SR S S SY P R+ +S + G+ +RS Sbjct: 343 STRNSGSSYNRSNSSTRSSGTNSSRSSSSYSRGSSTSPSRSYTPDRSSSRSSNSGSYSRS 402 Query: 359 KTGKTPYSRNSAT*SRN 409 +G + S +S + SR+ Sbjct: 403 -SGSSYSSGSSGSYSRS 418 >ref|ZP_04552731.1| predicted protein [Bacteroides sp. 2_2_4] gi|262407586|ref|ZP_06084134.1| predicted protein [Bacteroides sp. 2_1_22] gi|294645728|ref|ZP_06723414.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a] gi|294808349|ref|ZP_06767104.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b] gi|345511942|ref|ZP_08791481.1| hypothetical protein BSAG_01121 [Bacteroides sp. D1] gi|229443619|gb|EEO49410.1| hypothetical protein BSAG_01121 [Bacteroides sp. D1] gi|229448060|gb|EEO53851.1| predicted protein [Bacteroides sp. 2_2_4] gi|262354394|gb|EEZ03486.1| predicted protein [Bacteroides sp. 2_1_22] gi|292638934|gb|EFF57266.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a] gi|294444425|gb|EFG13137.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b] gi|295085132|emb|CBK66655.1| hypothetical protein [Bacteroides xylanisolvens XB1A] Length = 444 Score = 58.5 bits (140), Expect = 8e-07 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 2/137 (1%) Frame = +2 Query: 5 NSRFSRRTDQGGDSNTPRRTTMGSDFSRNNRNHGRGSDEKNSSRFSRTDVRGGDSNTPRR 184 NS + + G + T R D++R+ N S S R + T R + T Sbjct: 283 NSSVGQSVRRSGSTGTNSRVVGTRDYTRSGSNSSVRSGSSYSRRNTETYTRPSSTRTSGT 342 Query: 185 TTMNSDFSRNRTNR--RGTEDNVSQNSSRFSRRSDVERSDSYIPRRTGRKSDSYGNGARS 358 +T NS S NR+N R + N S++SS +SR S S SY P R+ +S + G+ +RS Sbjct: 343 STRNSGSSYNRSNSSTRSSGTNSSRSSSSYSRGSSTSPSRSYTPDRSSSRSSNSGSYSRS 402 Query: 359 KTGKTPYSRNSAT*SRN 409 +G + S +S + SR+ Sbjct: 403 -SGSSYSSGSSGSYSRS 418