BLASTX nr result
ID: Scutellaria22_contig00018577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00018577 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553393.1| PREDICTED: cytokinin dehydrogenase 1-like [G... 97 9e-27 emb|CAN76251.1| hypothetical protein VITISV_025507 [Vitis vinifera] 98 2e-26 emb|CBI33379.3| unnamed protein product [Vitis vinifera] 98 2e-26 ref|XP_002284560.1| PREDICTED: cytokinin dehydrogenase 1-like [V... 98 2e-26 ref|NP_001244203.1| cytokinin dehydrogenase 1-like [Glycine max]... 96 2e-26 >ref|XP_003553393.1| PREDICTED: cytokinin dehydrogenase 1-like [Glycine max] Length = 545 Score = 97.4 bits (241), Expect(2) = 9e-27 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = +2 Query: 80 YVSEIKLREIGLWEVPHPWLNLLIPRSRIHEFAQEVFGNILKDTSNGPVLIY 235 +VSE KLR GLWEVPHPWLNLLIPRS IH+FA+EVFGNILKDTSNGP+LIY Sbjct: 381 HVSENKLRAQGLWEVPHPWLNLLIPRSEIHDFAEEVFGNILKDTSNGPILIY 432 Score = 47.8 bits (112), Expect(2) = 9e-27 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 4 LLSELNYIRSTLFLSEVSYVEFLDRVRV 87 LLS+L+YI STLFLSEVSYVEFLDRV V Sbjct: 355 LLSKLSYIPSTLFLSEVSYVEFLDRVHV 382 >emb|CAN76251.1| hypothetical protein VITISV_025507 [Vitis vinifera] Length = 578 Score = 97.8 bits (242), Expect(2) = 2e-26 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +2 Query: 80 YVSEIKLREIGLWEVPHPWLNLLIPRSRIHEFAQEVFGNILKDTSNGPVLIY 235 +VSEIKLR GLWEVPHPWLNLLIP+SRIH+FA+EVFGNIL+DT NGP+LIY Sbjct: 427 HVSEIKLRAKGLWEVPHPWLNLLIPKSRIHDFAKEVFGNILRDTGNGPILIY 478 Score = 46.6 bits (109), Expect(2) = 2e-26 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 1 TLLSELNYIRSTLFLSEVSYVEFLDRVRV 87 +LLSEL+YI STLFLSEV YV+FLDRV V Sbjct: 400 SLLSELSYIPSTLFLSEVPYVDFLDRVHV 428 >emb|CBI33379.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 97.8 bits (242), Expect(2) = 2e-26 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +2 Query: 80 YVSEIKLREIGLWEVPHPWLNLLIPRSRIHEFAQEVFGNILKDTSNGPVLIY 235 +VSEIKLR GLWEVPHPWLNLLIP+SRIH+FA+EVFGNIL+DT NGP+LIY Sbjct: 381 HVSEIKLRAKGLWEVPHPWLNLLIPKSRIHDFAKEVFGNILRDTGNGPILIY 432 Score = 46.6 bits (109), Expect(2) = 2e-26 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 1 TLLSELNYIRSTLFLSEVSYVEFLDRVRV 87 +LLSEL+YI STLFLSEV YV+FLDRV V Sbjct: 354 SLLSELSYIPSTLFLSEVPYVDFLDRVHV 382 >ref|XP_002284560.1| PREDICTED: cytokinin dehydrogenase 1-like [Vitis vinifera] Length = 530 Score = 97.8 bits (242), Expect(2) = 2e-26 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +2 Query: 80 YVSEIKLREIGLWEVPHPWLNLLIPRSRIHEFAQEVFGNILKDTSNGPVLIY 235 +VSEIKLR GLWEVPHPWLNLLIP+SRIH+FA+EVFGNIL+DT NGP+LIY Sbjct: 361 HVSEIKLRAKGLWEVPHPWLNLLIPKSRIHDFAKEVFGNILRDTGNGPILIY 412 Score = 46.6 bits (109), Expect(2) = 2e-26 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 1 TLLSELNYIRSTLFLSEVSYVEFLDRVRV 87 +LLSEL+YI STLFLSEV YV+FLDRV V Sbjct: 334 SLLSELSYIPSTLFLSEVPYVDFLDRVHV 362 >ref|NP_001244203.1| cytokinin dehydrogenase 1-like [Glycine max] gi|379141569|gb|AFC97133.1| cytokinin dehydrogenase 1 [Glycine max] Length = 545 Score = 95.5 bits (236), Expect(2) = 2e-26 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +2 Query: 80 YVSEIKLREIGLWEVPHPWLNLLIPRSRIHEFAQEVFGNILKDTSNGPVLIY 235 +VSE KLR GLWEVPHPWLNLLIPRS IH FA+EVFGNILKDT+NGP+LIY Sbjct: 381 HVSEKKLRAQGLWEVPHPWLNLLIPRSEIHNFAEEVFGNILKDTNNGPILIY 432 Score = 48.5 bits (114), Expect(2) = 2e-26 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 4 LLSELNYIRSTLFLSEVSYVEFLDRVRV*NKTPR 105 LLS+L+YI STLFLSEVSYVEFLDRV V K R Sbjct: 355 LLSKLSYIPSTLFLSEVSYVEFLDRVHVSEKKLR 388