BLASTX nr result
ID: Scutellaria22_contig00018340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00018340 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002885043.1| hypothetical protein ARALYDRAFT_897714 [Arab... 79 3e-13 dbj|BAB01046.1| phosphate/phosphoenolpyruvate translocator prote... 78 6e-13 ref|NP_566487.1| Nucleotide/sugar transporter family protein [Ar... 78 6e-13 ref|XP_002263478.1| PREDICTED: probable sugar phosphate/phosphat... 75 7e-12 ref|XP_003546772.1| PREDICTED: probable sugar phosphate/phosphat... 70 2e-10 >ref|XP_002885043.1| hypothetical protein ARALYDRAFT_897714 [Arabidopsis lyrata subsp. lyrata] gi|297330883|gb|EFH61302.1| hypothetical protein ARALYDRAFT_897714 [Arabidopsis lyrata subsp. lyrata] Length = 339 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 223 MADWYRKWVREEFKTYAYILLYIALSSGQIFFNKWILSSKEINFPY 360 MAD + ++R+EF TYAYILLYIALSSGQIFFNKW+LSSKEINFPY Sbjct: 1 MADRSKGFMRDEFVTYAYILLYIALSSGQIFFNKWVLSSKEINFPY 46 >dbj|BAB01046.1| phosphate/phosphoenolpyruvate translocator protein-like [Arabidopsis thaliana] Length = 339 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +1 Query: 223 MADWYRKWVREEFKTYAYILLYIALSSGQIFFNKWILSSKEINFPY 360 MAD + ++R EF TYAYILLYIALSSGQIFFNKW+LSSKEINFPY Sbjct: 1 MADRSKGFMRAEFVTYAYILLYIALSSGQIFFNKWVLSSKEINFPY 46 >ref|NP_566487.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] gi|75165421|sp|Q94EI9.1|PT314_ARATH RecName: Full=Probable sugar phosphate/phosphate translocator At3g14410 gi|15294190|gb|AAK95272.1|AF410286_1 AT3g14410/MLN21_19 [Arabidopsis thaliana] gi|20147279|gb|AAM10353.1| AT3g14410/MLN21_19 [Arabidopsis thaliana] gi|332641993|gb|AEE75514.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] Length = 340 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +1 Query: 223 MADWYRKWVREEFKTYAYILLYIALSSGQIFFNKWILSSKEINFPY 360 MAD + ++R EF TYAYILLYIALSSGQIFFNKW+LSSKEINFPY Sbjct: 1 MADRSKGFMRAEFVTYAYILLYIALSSGQIFFNKWVLSSKEINFPY 46 >ref|XP_002263478.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g14410 [Vitis vinifera] gi|297745469|emb|CBI40549.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = +1 Query: 223 MADWYRKWVREEFKTYAYILLYIALSSGQIFFNKWILSSKEINFPY 360 MAD +K++ E TYAYILLYIALSSGQIFFNKW+LSSKEINFPY Sbjct: 1 MADREKKFLSEGTITYAYILLYIALSSGQIFFNKWVLSSKEINFPY 46 >ref|XP_003546772.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g14410-like [Glycine max] Length = 333 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 259 FKTYAYILLYIALSSGQIFFNKWILSSKEINFPY 360 F TYAYILLYIALSSGQIFFNKW+LSSKEINFPY Sbjct: 9 FLTYAYILLYIALSSGQIFFNKWVLSSKEINFPY 42