BLASTX nr result
ID: Scutellaria22_contig00018247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00018247 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529304.1| Desacetoxyvindoline 4-hydroxylase, putative ... 59 4e-07 ref|XP_002529305.1| Desacetoxyvindoline 4-hydroxylase, putative ... 55 6e-06 >ref|XP_002529304.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531228|gb|EEF33073.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 363 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 466 EELLSEDNPARFRATTVKEYVDHFNTKGLDGTSAL 362 +ELLSE+NP ++R TTVKE+V HFN KGLDGTSAL Sbjct: 324 KELLSEENPPKYRETTVKEFVSHFNAKGLDGTSAL 358 >ref|XP_002529305.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531229|gb|EEF33074.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 363 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -2 Query: 466 EELLSEDNPARFRATTVKEYVDHFNTKGLDGTSAL 362 +ELLSE+NP ++R TTV+EY DH+ KGLDGTSAL Sbjct: 324 KELLSEENPPKYRETTVREYSDHYKGKGLDGTSAL 358