BLASTX nr result
ID: Scutellaria22_contig00018118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00018118 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529511.1| PREDICTED: uncharacterized protein LOC100795... 57 2e-06 ref|XP_003529510.1| PREDICTED: uncharacterized protein LOC100795... 56 4e-06 ref|NP_001237215.1| uncharacterized protein LOC100500640 precurs... 55 6e-06 >ref|XP_003529511.1| PREDICTED: uncharacterized protein LOC100795394 isoform 2 [Glycine max] Length = 183 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/68 (36%), Positives = 44/68 (64%) Frame = +3 Query: 27 ISLTILVTLMIVNTEAVEAQNQRLIETTCKNTPNDKLCTAILRATPGSGGADLPELGLIM 206 +S+ +++++ + + +N++LIE TC+ TPN +C L+A+PGS AD+ L IM Sbjct: 15 LSIIVMISIPSSHCRTLLPENEKLIENTCRKTPNYNVCLESLKASPGSSSADVTGLAQIM 74 Query: 207 VGEVKKKS 230 V E+K K+ Sbjct: 75 VKEMKAKA 82 >ref|XP_003529510.1| PREDICTED: uncharacterized protein LOC100795394 isoform 1 [Glycine max] Length = 178 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/68 (35%), Positives = 44/68 (64%) Frame = +3 Query: 27 ISLTILVTLMIVNTEAVEAQNQRLIETTCKNTPNDKLCTAILRATPGSGGADLPELGLIM 206 +++ +++++ + + +N++LIE TC+ TPN +C L+A+PGS AD+ L IM Sbjct: 10 LAIIVMISIPSSHCRTLLPENEKLIENTCRKTPNYNVCLESLKASPGSSSADVTGLAQIM 69 Query: 207 VGEVKKKS 230 V E+K K+ Sbjct: 70 VKEMKAKA 77 >ref|NP_001237215.1| uncharacterized protein LOC100500640 precursor [Glycine max] gi|255630835|gb|ACU15780.1| unknown [Glycine max] Length = 184 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 3/69 (4%) Frame = +3 Query: 33 LTILVTLMIVNTEAVEA---QNQRLIETTCKNTPNDKLCTAILRATPGSGGADLPELGLI 203 L I+V + I ++ +N++LIE TCK TPN +C L+A+PGS AD+ L I Sbjct: 14 LAIVVMISIPSSHCSRTLLPENEKLIENTCKKTPNYNVCLESLKASPGSSSADVTGLAQI 73 Query: 204 MVGEVKKKS 230 MV E+K K+ Sbjct: 74 MVKEMKAKA 82