BLASTX nr result
ID: Scutellaria22_contig00018085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00018085 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 53 5e-06 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 53.1 bits (126), Expect(2) = 5e-06 Identities = 24/72 (33%), Positives = 42/72 (58%) Frame = -3 Query: 266 QGDRIHATIKRSLMDKFDGVLKEGHLFAVRDFFVAPNNMKYKTTNNDYNIIFYKKTHVFE 87 +G +H I + ++K+ +LK G ++++R+F V N YKT+ + Y + FY KT V E Sbjct: 50 EGTVLHVNIPKEFVEKYSAMLKIGQVYSIRNFLVISNFYTYKTSPHKYMLKFYYKTVVRE 109 Query: 86 FFDDAFPISLYQ 51 D FP +++ Sbjct: 110 LKDIVFPSHMFR 121 Score = 21.9 bits (45), Expect(2) = 5e-06 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 408 VRLYQVPVIGKKEEIFRMDAVFHDKQ 331 +R Y+VP I + +FHDK+ Sbjct: 25 IRSYEVPERRGAASIKCQECIFHDKE 50