BLASTX nr result
ID: Scutellaria22_contig00016339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016339 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002892454.1| endomembrane protein 70 family protein [Arab... 59 4e-07 gb|AAF22904.1|AC006932_21 T27G7.5 [Arabidopsis thaliana] 59 5e-07 ref|NP_001077489.1| endomembrane protein 70-like protein [Arabid... 59 5e-07 ref|XP_004172236.1| PREDICTED: LOW QUALITY PROTEIN: putative pha... 58 7e-07 ref|XP_004139482.1| PREDICTED: putative phagocytic receptor 1b-l... 58 7e-07 >ref|XP_002892454.1| endomembrane protein 70 family protein [Arabidopsis lyrata subsp. lyrata] gi|297338296|gb|EFH68713.1| endomembrane protein 70 family protein [Arabidopsis lyrata subsp. lyrata] Length = 589 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 201 SASTYNVGDPVPLFVNKIGPLHNPSETYKYY 293 S++ YN GD VPLFVNK+GPLHNPSETY+YY Sbjct: 25 SSNRYNAGDHVPLFVNKVGPLHNPSETYQYY 55 >gb|AAF22904.1|AC006932_21 T27G7.5 [Arabidopsis thaliana] Length = 536 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 201 SASTYNVGDPVPLFVNKIGPLHNPSETYKYY 293 S++ YN GD VPLFVNK+GPLHNPSETY+YY Sbjct: 25 SSNHYNAGDHVPLFVNKVGPLHNPSETYQYY 55 >ref|NP_001077489.1| endomembrane protein 70-like protein [Arabidopsis thaliana] gi|332190159|gb|AEE28280.1| endomembrane protein 70-like protein [Arabidopsis thaliana] Length = 589 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 201 SASTYNVGDPVPLFVNKIGPLHNPSETYKYY 293 S++ YN GD VPLFVNK+GPLHNPSETY+YY Sbjct: 25 SSNHYNAGDHVPLFVNKVGPLHNPSETYQYY 55 >ref|XP_004172236.1| PREDICTED: LOW QUALITY PROTEIN: putative phagocytic receptor 1b-like, partial [Cucumis sativus] Length = 307 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 213 YNVGDPVPLFVNKIGPLHNPSETYKYY 293 YNVGDPVPLFVNK+GPL NPSETY+YY Sbjct: 34 YNVGDPVPLFVNKVGPLTNPSETYQYY 60 >ref|XP_004139482.1| PREDICTED: putative phagocytic receptor 1b-like [Cucumis sativus] Length = 593 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 213 YNVGDPVPLFVNKIGPLHNPSETYKYY 293 YNVGDPVPLFVNK+GPL NPSETY+YY Sbjct: 34 YNVGDPVPLFVNKVGPLTNPSETYQYY 60