BLASTX nr result
ID: Scutellaria22_contig00016249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016249 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283676.1| PREDICTED: monoglyceride lipase [Vitis vinif... 77 1e-12 >ref|XP_002283676.1| PREDICTED: monoglyceride lipase [Vitis vinifera] gi|147865769|emb|CAN83251.1| hypothetical protein VITISV_034794 [Vitis vinifera] Length = 399 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/53 (67%), Positives = 47/53 (88%) Frame = +1 Query: 58 MEELTSGASGRIIPVFRNLRQLILSYDSFRKSLLLIYSFFVWILLLIPRRHRI 216 MEELTSGASGRIIPVFRNLR+ +LS+ S R+SL+ I+S F+W++LL+P RHR+ Sbjct: 6 MEELTSGASGRIIPVFRNLRRSVLSWQSIRRSLIFIHSIFLWLILLLP-RHRL 57