BLASTX nr result
ID: Scutellaria22_contig00016248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016248 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283676.1| PREDICTED: monoglyceride lipase [Vitis vinif... 79 3e-13 >ref|XP_002283676.1| PREDICTED: monoglyceride lipase [Vitis vinifera] gi|147865769|emb|CAN83251.1| hypothetical protein VITISV_034794 [Vitis vinifera] Length = 399 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/53 (69%), Positives = 48/53 (90%) Frame = +3 Query: 300 MEELTSGASGRIIPVFRNLRQSILSYDSFRKSLLLIYSFFVWILLLIPRRHRI 458 MEELTSGASGRIIPVFRNLR+S+LS+ S R+SL+ I+S F+W++LL+P RHR+ Sbjct: 6 MEELTSGASGRIIPVFRNLRRSVLSWQSIRRSLIFIHSIFLWLILLLP-RHRL 57