BLASTX nr result
ID: Scutellaria22_contig00016050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00016050 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517255.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 ref|XP_002314145.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002281924.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_002276778.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|NP_190271.1| pentatricopeptide repeat-containing protein [Ar... 58 9e-07 >ref|XP_002517255.1| conserved hypothetical protein [Ricinus communis] gi|223543626|gb|EEF45155.1| conserved hypothetical protein [Ricinus communis] Length = 258 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 189 RAYHDGRPRGPLWRGKKLIGKEAIFVIL 272 R YHDGRPRGPLWRGKKLIGKEA+FVIL Sbjct: 56 RQYHDGRPRGPLWRGKKLIGKEALFVIL 83 >ref|XP_002314145.1| predicted protein [Populus trichocarpa] gi|222850553|gb|EEE88100.1| predicted protein [Populus trichocarpa] Length = 257 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 189 RAYHDGRPRGPLWRGKKLIGKEAIFVIL 272 R YHDGRPRGPLWRGKKLIGKEA+FVIL Sbjct: 54 RQYHDGRPRGPLWRGKKLIGKEALFVIL 81 >ref|XP_002281924.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 isoform 1 [Vitis vinifera] gi|359478900|ref|XP_003632183.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 isoform 2 [Vitis vinifera] gi|297745987|emb|CBI16043.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 189 RAYHDGRPRGPLWRGKKLIGKEAIFVIL 272 + YHDGRPRGPLWRGKKLIGKEA+FVIL Sbjct: 50 KLYHDGRPRGPLWRGKKLIGKEALFVIL 77 >ref|XP_002276778.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870 [Vitis vinifera] gi|297745785|emb|CBI15841.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 195 YHDGRPRGPLWRGKKLIGKEAIFVIL 272 YHDGRPRGPLWRGKKLIGKEA+FVIL Sbjct: 52 YHDGRPRGPLWRGKKLIGKEALFVIL 77 >ref|NP_190271.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75266318|sp|Q9STF9.1|PP266_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g46870 gi|5541672|emb|CAB51178.1| putative protein [Arabidopsis thaliana] gi|26450732|dbj|BAC42475.1| unknown protein [Arabidopsis thaliana] gi|28950815|gb|AAO63331.1| At3g46870 [Arabidopsis thaliana] gi|332644692|gb|AEE78213.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 257 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 183 FDRAYHDGRPRGPLWRGKKLIGKEAIFVIL 272 F +HDGRPRGPLWRGKKLIGKEA+FVIL Sbjct: 53 FVSRFHDGRPRGPLWRGKKLIGKEALFVIL 82