BLASTX nr result
ID: Scutellaria22_contig00015829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00015829 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19206.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002285736.1| PREDICTED: blue copper protein-like [Vitis v... 58 7e-07 emb|CAN61581.1| hypothetical protein VITISV_008034 [Vitis vinifera] 58 7e-07 ref|XP_002302318.1| predicted protein [Populus trichocarpa] gi|1... 57 1e-06 gb|ABK92755.1| unknown [Populus trichocarpa] 57 1e-06 >emb|CBI19206.3| unnamed protein product [Vitis vinifera] Length = 206 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 151 YTVGDTSGWSIGADYATWSSGKTFSVGDTL 240 YTVGD++GW++GADY+TW+SGKTF VGDTL Sbjct: 44 YTVGDSTGWTMGADYSTWTSGKTFVVGDTL 73 >ref|XP_002285736.1| PREDICTED: blue copper protein-like [Vitis vinifera] Length = 187 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 151 YTVGDTSGWSIGADYATWSSGKTFSVGDTL 240 YTVGD++GW++GADY+TW+SGKTF VGDTL Sbjct: 25 YTVGDSTGWTMGADYSTWTSGKTFVVGDTL 54 >emb|CAN61581.1| hypothetical protein VITISV_008034 [Vitis vinifera] Length = 187 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 151 YTVGDTSGWSIGADYATWSSGKTFSVGDTL 240 YTVGD++GW++GADY+TW+SGKTF VGDTL Sbjct: 25 YTVGDSTGWTMGADYSTWTSGKTFVVGDTL 54 >ref|XP_002302318.1| predicted protein [Populus trichocarpa] gi|118482561|gb|ABK93201.1| unknown [Populus trichocarpa] gi|222844044|gb|EEE81591.1| predicted protein [Populus trichocarpa] Length = 188 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 151 YTVGDTSGWSIGADYATWSSGKTFSVGDTL 240 +TVGD+SGW+IG DY+TW+SGKTFSVGD+L Sbjct: 28 HTVGDSSGWAIGMDYSTWTSGKTFSVGDSL 57 >gb|ABK92755.1| unknown [Populus trichocarpa] Length = 188 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 151 YTVGDTSGWSIGADYATWSSGKTFSVGDTL 240 +TVGD+SGW+IG DY+TW+SGKTFSVGD+L Sbjct: 28 HTVGDSSGWAIGMDYSTWTSGKTFSVGDSL 57