BLASTX nr result
ID: Scutellaria22_contig00015658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00015658 (634 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329121.1| predicted protein [Populus trichocarpa] gi|2... 66 6e-09 ref|XP_002318138.1| predicted protein [Populus trichocarpa] gi|2... 60 3e-07 ref|XP_002318137.1| predicted protein [Populus trichocarpa] gi|2... 60 3e-07 ref|XP_003627635.1| F-box protein [Medicago truncatula] gi|35552... 60 3e-07 ref|XP_003599499.1| F-box protein [Medicago truncatula] gi|35548... 59 6e-07 >ref|XP_002329121.1| predicted protein [Populus trichocarpa] gi|222869790|gb|EEF06921.1| predicted protein [Populus trichocarpa] Length = 92 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/65 (44%), Positives = 45/65 (69%) Frame = +1 Query: 388 LPSEVIIEILSRLPARTVLSCKCVCKSWLNLLEAHEFAESHLSKSVPGLAIYHEPKNCPA 567 L ++V+I+ILSR P +T+LS +CVCK+WL L+ +FA HLS+S PG+ I P+ + Sbjct: 16 LSADVMIDILSRFPLKTILSFRCVCKTWLRLISDKDFANPHLSRSPPGILIKALPEGGIS 75 Query: 568 SYKIF 582 + +F Sbjct: 76 KWSLF 80 >ref|XP_002318138.1| predicted protein [Populus trichocarpa] gi|222858811|gb|EEE96358.1| predicted protein [Populus trichocarpa] Length = 272 Score = 60.5 bits (145), Expect = 3e-07 Identities = 33/85 (38%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = +1 Query: 373 GCFKYLPSEVIIEILSRLPARTVLSCKCVCKSWLNLLEAHEFAESHLSKSVPGLAIYHEP 552 GC LP +VIIEILS LP +T+L KCVCKSW ++ + F HL+ + H Sbjct: 6 GCL--LPEDVIIEILSLLPVKTLLQFKCVCKSWYGIITSSNFISLHLNNHYNNIKSGHLL 63 Query: 553 KN--CPASYKIFEFEDVIDLEDHEL 621 + CP ++F+ E + DL L Sbjct: 64 AHFVCPQLLELFQDESLTDLSHQGL 88 >ref|XP_002318137.1| predicted protein [Populus trichocarpa] gi|222858810|gb|EEE96357.1| predicted protein [Populus trichocarpa] Length = 367 Score = 60.5 bits (145), Expect = 3e-07 Identities = 33/85 (38%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = +1 Query: 373 GCFKYLPSEVIIEILSRLPARTVLSCKCVCKSWLNLLEAHEFAESHLSKSVPGLAIYHEP 552 GC LP +VIIEILS LP +T+L KCVCKSW ++ + F HL+ + H Sbjct: 6 GCL--LPEDVIIEILSLLPVKTLLQFKCVCKSWYGIITSSNFISLHLNNHYNNIKSGHLL 63 Query: 553 KN--CPASYKIFEFEDVIDLEDHEL 621 + CP ++F+ E + DL L Sbjct: 64 AHFVCPQLLELFQDESLTDLSHQGL 88 >ref|XP_003627635.1| F-box protein [Medicago truncatula] gi|355521657|gb|AET02111.1| F-box protein [Medicago truncatula] Length = 372 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/73 (41%), Positives = 44/73 (60%) Frame = +1 Query: 385 YLPSEVIIEILSRLPARTVLSCKCVCKSWLNLLEAHEFAESHLSKSVPGLAIYHEPKNCP 564 YLPSE+II+IL RLP +++L KC+CKSWL+L+ FA SH+ S + + Sbjct: 39 YLPSELIIQILLRLPVKSLLCFKCICKSWLSLISDPHFANSHVDVSAAKIVSISRTRPL- 97 Query: 565 ASYKIFEFEDVID 603 A + +FE I+ Sbjct: 98 AEIRFIDFETSIN 110 >ref|XP_003599499.1| F-box protein [Medicago truncatula] gi|355488547|gb|AES69750.1| F-box protein [Medicago truncatula] Length = 489 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = +1 Query: 385 YLPSEVIIEILSRLPARTVLSCKCVCKSWLNLLEAHEFAESHLSKS 522 YLP E+II+I+ RLP ++++ KCVCKSWL L+ H FA+SH S Sbjct: 122 YLPHELIIQIMLRLPVKSLIRFKCVCKSWLALISDHNFAKSHFELS 167