BLASTX nr result
ID: Scutellaria22_contig00012884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00012884 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282442.1| PREDICTED: potassium channel AKT1 [Vitis vin... 187 8e-46 emb|CAG27094.1| inwardly rectifying potassium channel subunit [D... 186 1e-45 emb|CBW30481.1| inward rectifying shaker-like K+ channel [Vitis ... 186 2e-45 emb|CAN78157.1| hypothetical protein VITISV_032798 [Vitis vinifera] 186 2e-45 ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like [Viti... 184 7e-45 >ref|XP_002282442.1| PREDICTED: potassium channel AKT1 [Vitis vinifera] gi|296081992|emb|CBI20997.3| unnamed protein product [Vitis vinifera] Length = 898 Score = 187 bits (475), Expect = 8e-46 Identities = 86/108 (79%), Positives = 97/108 (89%) Frame = -2 Query: 326 AWVSPFEFGFLDKPTGPLPIVDNVVNGFFAIDIILTFFVAYLDKHSYLLIDNRRLIAWKY 147 AWVSPFEFGFL++P GPL I DNVVNGFFAIDIILTFFVAYLD+ +YLL+DN +LIAW+Y Sbjct: 83 AWVSPFEFGFLEEPKGPLSIADNVVNGFFAIDIILTFFVAYLDRSTYLLVDNHKLIAWRY 142 Query: 146 ASTWLAFDIISTIPSELARKMSPKPLRTYGLFNMLRLWRLRRVGSLFA 3 TWLAFD+ISTIPSELARK+ PKPL+ YG FNMLRLWRLRRV S+FA Sbjct: 143 TKTWLAFDVISTIPSELARKILPKPLKEYGYFNMLRLWRLRRVSSMFA 190 >emb|CAG27094.1| inwardly rectifying potassium channel subunit [Daucus carota] Length = 873 Score = 186 bits (473), Expect = 1e-45 Identities = 88/108 (81%), Positives = 98/108 (90%) Frame = -2 Query: 326 AWVSPFEFGFLDKPTGPLPIVDNVVNGFFAIDIILTFFVAYLDKHSYLLIDNRRLIAWKY 147 AWVSPFE GFL K PL ++DNVVNGFFAIDI+LTFFVAYLD+++YLLID+R+LIAWKY Sbjct: 72 AWVSPFELGFLHKARPPLSVLDNVVNGFFAIDIVLTFFVAYLDRNTYLLIDDRKLIAWKY 131 Query: 146 ASTWLAFDIISTIPSELARKMSPKPLRTYGLFNMLRLWRLRRVGSLFA 3 STWLAFD+ISTIPSELA K+SP PLRTYGLFNMLRLWRLRRV SLFA Sbjct: 132 TSTWLAFDVISTIPSELALKISPSPLRTYGLFNMLRLWRLRRVSSLFA 179 >emb|CBW30481.1| inward rectifying shaker-like K+ channel [Vitis vinifera] gi|310913174|emb|CBW30482.1| inward rectifying shaker-like K+ channel [Vitis vinifera] Length = 898 Score = 186 bits (472), Expect = 2e-45 Identities = 86/108 (79%), Positives = 96/108 (88%) Frame = -2 Query: 326 AWVSPFEFGFLDKPTGPLPIVDNVVNGFFAIDIILTFFVAYLDKHSYLLIDNRRLIAWKY 147 AWVSPFEFGFL +P GPL I DNVVNGFFAIDIILTFFVAYLD+ +YLL+DN +LIAW+Y Sbjct: 83 AWVSPFEFGFLKEPKGPLSIADNVVNGFFAIDIILTFFVAYLDRSTYLLVDNHKLIAWRY 142 Query: 146 ASTWLAFDIISTIPSELARKMSPKPLRTYGLFNMLRLWRLRRVGSLFA 3 TWLAFD+ISTIPSELARK+ PKPL+ YG FNMLRLWRLRRV S+FA Sbjct: 143 TKTWLAFDVISTIPSELARKILPKPLKEYGYFNMLRLWRLRRVSSMFA 190 >emb|CAN78157.1| hypothetical protein VITISV_032798 [Vitis vinifera] Length = 898 Score = 186 bits (472), Expect = 2e-45 Identities = 86/108 (79%), Positives = 96/108 (88%) Frame = -2 Query: 326 AWVSPFEFGFLDKPTGPLPIVDNVVNGFFAIDIILTFFVAYLDKHSYLLIDNRRLIAWKY 147 AWVSPFEFGFL +P GPL I DNVVNGFFAIDIILTFFVAYLD+ +YLL+DN +LIAW+Y Sbjct: 83 AWVSPFEFGFLXEPKGPLSIADNVVNGFFAIDIILTFFVAYLDRSTYLLVDNHKLIAWRY 142 Query: 146 ASTWLAFDIISTIPSELARKMSPKPLRTYGLFNMLRLWRLRRVGSLFA 3 TWLAFD+ISTIPSELARK+ PKPL+ YG FNMLRLWRLRRV S+FA Sbjct: 143 TKTWLAFDVISTIPSELARKILPKPLKEYGYFNMLRLWRLRRVSSMFA 190 >ref|XP_002281787.1| PREDICTED: potassium channel AKT1-like [Vitis vinifera] Length = 872 Score = 184 bits (467), Expect = 7e-45 Identities = 85/108 (78%), Positives = 95/108 (87%) Frame = -2 Query: 326 AWVSPFEFGFLDKPTGPLPIVDNVVNGFFAIDIILTFFVAYLDKHSYLLIDNRRLIAWKY 147 AWVSPFEFGFL KP PL I DNVVNGFFA+DI+LTFFVAYLDK +YLL+DN + IAWKY Sbjct: 77 AWVSPFEFGFLKKPEAPLSITDNVVNGFFAVDIVLTFFVAYLDKTTYLLVDNPKQIAWKY 136 Query: 146 ASTWLAFDIISTIPSELARKMSPKPLRTYGLFNMLRLWRLRRVGSLFA 3 STWLAFD+ISTIPSELARK++P P ++YG FNMLRLWRLRRV SLFA Sbjct: 137 TSTWLAFDVISTIPSELARKITPSPFQSYGFFNMLRLWRLRRVSSLFA 184